Recombinant Mouse SCRG1 Protein (21-98 aa), His-SUMO-tagged

• Cat.No.: SCRG1-991M
• Product Overview: Recombinant Mouse SCRG1 Protein (21-98 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 21-98 aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 25.0 kDa
• AA Sequence: MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Scrg1 scrapie responsive gene 1 [ Mus musculus (house mouse) ]
• Official Symbol: SCRG1
• Synonyms: AW124307
• Gene ID: 20284
• mRNA Refseq: NM_009136
• Protein Refseq: NP_033162
• UniProt ID: O88745