Recombinant Mouse SDF2 Protein (19-211 aa), His-Myc-tagged

Cat.No. : SDF2-2105M
Product Overview : Recombinant Mouse SDF2 Protein (19-211 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 19-211 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 26.4 kDa
AA Sequence : SNMAVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKTATVCERGTPIKCGQPIRLTHINTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTDVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLRAEVHHAEL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Sdf2 stromal cell derived factor 2 [ Mus musculus ]
Official Symbol SDF2
Synonyms SDF2; stromal cell derived factor 2; SDF-2; AI853825; MGC107120;
Gene ID 20316
mRNA Refseq NM_009143
Protein Refseq NP_033169
UniProt ID Q9DCT5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SDF2 Products

Required fields are marked with *

My Review for All SDF2 Products

Required fields are marked with *

0
cart-icon