Recombinant Mouse SDF2 Protein (19-211 aa), His-Myc-tagged
| Cat.No. : | SDF2-2105M |
| Product Overview : | Recombinant Mouse SDF2 Protein (19-211 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 19-211 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 26.4 kDa |
| AA Sequence : | SNMAVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKTATVCERGTPIKCGQPIRLTHINTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTDVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLRAEVHHAEL |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Sdf2 stromal cell derived factor 2 [ Mus musculus ] |
| Official Symbol | SDF2 |
| Synonyms | SDF2; stromal cell derived factor 2; SDF-2; AI853825; MGC107120; |
| Gene ID | 20316 |
| mRNA Refseq | NM_009143 |
| Protein Refseq | NP_033169 |
| UniProt ID | Q9DCT5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDF2 Products
Required fields are marked with *
My Review for All SDF2 Products
Required fields are marked with *
Recently Viewed
