Recombinant Mouse SERPINA3N Protein (21-418 aa), His-SUMO-tagged

• Cat.No.: SERPINA3N-1072M
• Product Overview: Recombinant Mouse SERPINA3N Protein (21-418 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full length protein(mutation).

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 21-418 aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 60.8 kDa
• AA Sequence: SFPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Serpina3n serine (or cysteine) peptidase inhibitor, clade A, member 3N [ Mus musculus (house mouse) ]
• Official Symbol: SERPINA3N
• Synonyms: Spi2-2; Spi2.2; Spi2/eb.4
• Gene ID: 20716
• UniProt ID: Q91WP6