Recombinant Mouse SERPINA3N Protein (21-418 aa), His-tagged
Cat.No. : | SERPINA3N-1695M |
Product Overview : | Recombinant Mouse SERPINA3N Protein (21-418 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: full length protein(mutation). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 21-418 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 46.8 kDa |
AA Sequence : | SFPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Serpina3n serine (or cysteine) peptidase inhibitor, clade A, member 3N [ Mus musculus (house mouse) ] |
Official Symbol | SERPINA3N |
Synonyms | Spi2-2; Spi2.2; Spi2/eb.4; |
Gene ID | 20716 |
UniProt ID | Q91WP6 |
◆ Recombinant Proteins | ||
SERPINA3N-1695M | Recombinant Mouse SERPINA3N Protein (21-418 aa), His-tagged | +Inquiry |
Serpina3n-5728M | Recombinant Mouse Serpina3n protein, His & T7-tagged | +Inquiry |
SERPINA3N-4997R | Recombinant Rat SERPINA3N Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINA3N-5338R | Recombinant Rat SERPINA3N Protein | +Inquiry |
Serpina3n-532R | Recombinant Rat Serpina3n protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINA3N Products
Required fields are marked with *
My Review for All SERPINA3N Products
Required fields are marked with *
0
Inquiry Basket