Recombinant Mouse Serpinb5 protein
| Cat.No. : | Serpinb5-5081M |
| Product Overview : | Recombinant Mouse Serpinb5 protein(P70124)(1-375 aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 1-375 aa |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | MDALRLANSAFAVDLFKQLCERDPAGNILFSPICLSTSLSLAQVGTKGDTANEIGQVLHF ENVKDVPFGFQTVTSDVNKLSSFYSLKLVKRLYIDKSLNPSTEFISSTKRPYAKELETVD FKDKLEETKGQINSSIKELTDGHFEDILSENSISDQTKILVVNAAYFVGKWMKKFPESET KECPFRISKTDTKPVQMMNLEATFCLGNIDDISCKIIELPFQNKHLSMLIVLPKDVEDES TGLEKIEQQLNPETLLQWTNPSTMANAKVKLSLPKFKVEKMIDPKASLESLGLKSLFNES TSDFSGMSETKGVSLSNVIHRVCLEITEDGGESIEVPGSRILQHKDEFNADHPFIYIIRH NKTRNIIFFGKFCSP |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Serpinb5 serine (or cysteine) peptidase inhibitor, clade B, member 5 [ Mus musculus ] |
| Official Symbol | Serpinb5 |
| Synonyms | SERPINB5; serine (or cysteine) peptidase inhibitor, clade B, member 5; serpin B5; protease inhibitor 5; peptidase inhibitor 5; serine protease inhibitor 7; serine (or cysteine) proteinase inhibitor, clade B, member 5; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 5; PI-5; Spi7; Maspin; AI462524; AI646751; ovalbumin; 1110036M19Rik; |
| Gene ID | 20724 |
| mRNA Refseq | NM_009257 |
| Protein Refseq | NP_033283 |
| ◆ Recombinant Proteins | ||
| SERPINB5-193H | Active Recombinant Human SERPINB5 protein | +Inquiry |
| Serpinb5-5084M | Recombinant Mouse Serpinb5 protein | +Inquiry |
| Serpinb5-5080M | Recombinant Mouse Serpinb5 protein | +Inquiry |
| SERPINB5-29133TH | Recombinant Human SERPINB5 | +Inquiry |
| SERPINB5-5914H | Recombinant Human SERPINB5 Protein (Met1-Lys189), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SERPINB5-1938HCL | Recombinant Human SERPINB5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Serpinb5 Products
Required fields are marked with *
My Review for All Serpinb5 Products
Required fields are marked with *
