Recombinant Mouse Serpinf1 Protein

Cat.No. : Serpinf1-139M
Product Overview : Purified recombinant protein of Mouse serine (or cysteine) peptidase inhibitor, clade F, member 1 (Serpinf1) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Neurotrophic protein; induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.
Molecular Mass : 42 kDa
AA Sequence : MDPFFKVPVNKLAAAVSNFGYDLYRLRSSASPTGNVLLSPLSVATALSALSLGAEHRTESVIHRALYYDLITNPDIHSTYKELLASVTAPEKNLKSASRIVFERKLRVKSSFVAPLEKSYGTRPRILTGNPRVDLQEINNWVQAQMKGKIARSTREMPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLDEDRTVRVPMMSDPKAILRYGLDSDLNCKIAQLPLTGSMSIIFFLPLTVTQNLTMIEESLTSEF
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name Serpinf1 serine (or cysteine) peptidase inhibitor, clade F, member 1 [ Mus musculus (house mouse) ]
Official Symbol Serpinf1
Synonyms Serpinf1; serine (or cysteine) peptidase inhibitor, clade F, member 1; Pedf; Sdf3; EPC-1; Pedfl; AI195227; pigment epithelium-derived factor; SDF-3; alpha-2 antiplasmin; caspin; serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1; serine (or cysteine) proteinase inhibitor, clade F), member 1; serine (or cysteine) proteinase inhibitor, clade F, member 1; serpin F1; stromal cell-derived factor 3
Gene ID 20317
mRNA Refseq NM_011340
Protein Refseq NP_035470
UniProt ID P97298

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Serpinf1 Products

Required fields are marked with *

My Review for All Serpinf1 Products

Required fields are marked with *

0
cart-icon