Recombinant Mouse SEZ6 protein, His-tagged
Cat.No. : | SEZ6-14M |
Product Overview : | Recombinant Human TCOF1 protein(Q13428)(Gln1251-Lys1480), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Gln1251-Lys1480 |
Tag : | C-His |
Form : | 0.15 M Phosphate buffered saline, pH 7.4 |
Molecular Mass : | 27kDa |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | QAAGMLSPKTGGKEAASGTTPQKSRKPKKGAGNPQASTLALQSNITQCLLGQPWPLNEAQVQASVVKVLTELLEQERKKVVDTTKESSRKGWESRKRKLSGDQPAARTPRSKKKKKLGAGEGGEASVSPEKTSTTSKGKAKRDKASGDVKEKKGKGSLGSQGAKDEPEEELQKGMGTVEGGDQSNPKSKKEKKKSDKRKKDKEKKEKKKKAKKASTKDSESPSQKKKKKK |
Gene Name | TCOF1 Treacher Collins-Franceschetti syndrome 1 [ Homo sapiens ] |
Official Symbol | TCOF1 |
Synonyms | TCOF1; Treacher Collins-Franceschetti syndrome 1; treacle protein; treacle; Treacher Collins syndrome protein; nucleolar trafficking phosphoprotein; MFD1; TCS1; |
Gene ID | 6949 |
mRNA Refseq | NM_000356 |
Protein Refseq | NP_000347 |
MIM | 606847 |
UniProt ID | Q13428 |
◆ Recombinant Proteins | ||
SEZ6-1597C | Recombinant Cynomolgus SEZ6 protein, His-tagged | +Inquiry |
SEZ6-12H | Recombinant Human SEZ6 protein, hFc-tagged | +Inquiry |
SEZ6-1987H | Recombinant Human SEZ6 Protein, His (Fc)-Avi-tagged | +Inquiry |
SEZ6-554HFL | Recombinant Full Length Human SEZ6 Protein, C-Flag-tagged | +Inquiry |
SEZ6-14M | Recombinant Mouse SEZ6 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SEZ6 Products
Required fields are marked with *
My Review for All SEZ6 Products
Required fields are marked with *
0
Inquiry Basket