Recombinant Mouse SEZ6 protein, His-tagged

• Cat.No.: SEZ6-14M
• Product Overview: Recombinant Human TCOF1 protein(Q13428)(Gln1251-Lys1480), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Gln1251-Lys1480
• Tag: C-His
• Form: 0.15 M Phosphate buffered saline, pH 7.4
• Molecular Mass: 27kDa
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: QAAGMLSPKTGGKEAASGTTPQKSRKPKKGAGNPQASTLALQSNITQCLLGQPWPLNEAQVQASVVKVLTELLEQERKKVVDTTKESSRKGWESRKRKLSGDQPAARTPRSKKKKKLGAGEGGEASVSPEKTSTTSKGKAKRDKASGDVKEKKGKGSLGSQGAKDEPEEELQKGMGTVEGGDQSNPKSKKEKKKSDKRKKDKEKKEKKKKAKKASTKDSESPSQKKKKKK

Gene Information

• Gene Name: TCOF1 Treacher Collins-Franceschetti syndrome 1 [ Homo sapiens ]
• Official Symbol: TCOF1
• Synonyms: TCOF1; Treacher Collins-Franceschetti syndrome 1; treacle protein; treacle; Treacher Collins syndrome protein; nucleolar trafficking phosphoprotein; MFD1; TCS1
• Gene ID: 6949
• mRNA Refseq: NM_000356
• Protein Refseq: NP_000347
• MIM: 606847
• UniProt ID: Q13428