Recombinant Mouse SEZ6 protein, His-tagged
| Cat.No. : | SEZ6-14M |
| Product Overview : | Recombinant Human TCOF1 protein(Q13428)(Gln1251-Lys1480), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Gln1251-Lys1480 |
| Tag : | C-His |
| Form : | 0.15 M Phosphate buffered saline, pH 7.4 |
| Molecular Mass : | 27kDa |
| Storage : | Store at -20°C to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | QAAGMLSPKTGGKEAASGTTPQKSRKPKKGAGNPQASTLALQSNITQCLLGQPWPLNEAQVQASVVKVLTELLEQERKKVVDTTKESSRKGWESRKRKLSGDQPAARTPRSKKKKKLGAGEGGEASVSPEKTSTTSKGKAKRDKASGDVKEKKGKGSLGSQGAKDEPEEELQKGMGTVEGGDQSNPKSKKEKKKSDKRKKDKEKKEKKKKAKKASTKDSESPSQKKKKKK |
| Gene Name | TCOF1 Treacher Collins-Franceschetti syndrome 1 [ Homo sapiens ] |
| Official Symbol | TCOF1 |
| Synonyms | TCOF1; Treacher Collins-Franceschetti syndrome 1; treacle protein; treacle; Treacher Collins syndrome protein; nucleolar trafficking phosphoprotein; MFD1; TCS1; |
| Gene ID | 6949 |
| mRNA Refseq | NM_000356 |
| Protein Refseq | NP_000347 |
| MIM | 606847 |
| UniProt ID | Q13428 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEZ6 Products
Required fields are marked with *
My Review for All SEZ6 Products
Required fields are marked with *
