Recombinant Mouse Sfrp2 Protein, His-tagged

Cat.No. : Sfrp2-008M
Product Overview : Recombinant mouse sFRP-2, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect cells
Tag : His
Description : Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP2 may be important for eye retinal development and for myogenesis.
Form : Liquid
Molecular Mass : 32.1 kDa
AA Sequence : LFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKTKNEDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -87 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by absorbance at 280nm)
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0) containing 100mM NaCl, 20% glycerol
Gene Name Sfrp2 secreted frizzled-related protein 2 [ Mus musculus (house mouse) ]
Official Symbol Sfrp2
Synonyms Sfrp2; secreted frizzled-related protein 2; Sdf; Sdf5; AI851596; secreted frizzled-related protein 2; SARP-1; sFRP-2; secreted apoptosis-related protein 1; secreted frizzled-related sequence protein 2; secreted frizzled-related sequence protein 5; stromal cell derived factor 5
Gene ID 20319
mRNA Refseq NM_009144
Protein Refseq NP_033170.1
UniProt ID P97299

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Sfrp2 Products

Required fields are marked with *

My Review for All Sfrp2 Products

Required fields are marked with *

0
cart-icon