Recombinant Mouse Sfrp5 protein, His-tagged
Cat.No. : | Sfrp5-3487M |
Product Overview : | Recombinant Mouse Sfrp5 protein(Q9WU66)(22-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-314aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.2 kDa |
AA Sequence : | APTRGQEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRSLCEAARAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIDNGDRKLIGAQKKKKLLKAGPLKRKDTKKLVLHMKNGASCPCPQLDNLTGSFLVMGRKVEGQLLLTAVYRWDKKNKEMKFAVKFMFSYPCSLYYPFFYGAAEPH |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Sfrp5 secreted frizzled-related sequence protein 5 [ Mus musculus ] |
Official Symbol | Sfrp5 |
Synonyms | SFRP5; secreted frizzled-related sequence protein 5; secreted frizzled-related protein 5; sFRP-5; SARP3; AI605071; |
Gene ID | 54612 |
mRNA Refseq | NM_018780 |
Protein Refseq | NP_061250 |
◆ Recombinant Proteins | ||
Sfrp5-712M | Active Recombinant Mouse Sfrp5 Protein, HA-tagged | +Inquiry |
Sfrp5-3487M | Recombinant Mouse Sfrp5 protein, His-tagged | +Inquiry |
SFRP5-2620H | Recombinant Human SFRP5 protein, His-tagged | +Inquiry |
SFRP5-2621H | Active Recombinant Human SFRP5 Protein, HA-tagged | +Inquiry |
SFRP5-254H | Recombinant Human SFRP5 protein, FLAG-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sfrp5 Products
Required fields are marked with *
My Review for All Sfrp5 Products
Required fields are marked with *