Recombinant Mouse Sftpc protein, His-KSI-tagged
Cat.No. : | Sftpc-3491M |
Product Overview : | Recombinant Mouse Sftpc protein(P21841)(24-58aa), fused to N-terminal His-KSI tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 24-58aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.1 kDa |
AA Sequence : | FRIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Sftpc surfactant associated protein C [ Mus musculus ] |
Official Symbol | Sftpc |
Synonyms | SFTPC; surfactant associated protein C; pulmonary surfactant-associated protein C; pulmonary surfactant-associated proteolipid SPL(Val); SP5; SP-C; Sftp2; Sftp-2; pro-SpC; |
Gene ID | 20389 |
mRNA Refseq | NM_011359 |
Protein Refseq | NP_035489 |
◆ Recombinant Proteins | ||
Sftpc-1722M | Recombinant Mouse Sftpc protein, His-tagged | +Inquiry |
SFTPC-5359R | Recombinant Rat SFTPC Protein | +Inquiry |
SFTPC-9988HFL | Recombinant Full Length Human SFTPC protein, Flag-tagged | +Inquiry |
SFTPC-5018R | Recombinant Rat SFTPC Protein, His (Fc)-Avi-tagged | +Inquiry |
SFTPC-3490H | Recombinant Human SFTPC protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFTPC-1896HCL | Recombinant Human SFTPC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sftpc Products
Required fields are marked with *
My Review for All Sftpc Products
Required fields are marked with *
0
Inquiry Basket