Recombinant Mouse SHANK3 Protein
Cat.No. : | SHANK3-12M |
Product Overview : | Recombinant Mouse SHANK3 Protein was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Protein Length : | 533 to 665 aa |
Description : | Enables ionotropic glutamate receptor binding activity; protein C-terminus binding activity; and scaffold protein binding activity. A structural constituent of postsynaptic density. Involved in several processes, including learning or memory; modulation of chemical synaptic transmission; and postsynapse organization. Acts upstream of or within several processes, including MAPK cascade; negative regulation of actin filament bundle assembly; and regulation of AMPA glutamate receptor clustering. Located in glutamatergic synapse and neuron spine. Is extrinsic component of cytoplasmic side of plasma membrane. Is expressed in brain and cerebral cortex. Used to study Phelan-McDermid syndrome; autism spectrum disorder; and schizophrenia. Human ortholog(s) of this gene implicated in Phelan-McDermid syndrome and schizophrenia 15. Orthologous to human SHANK3 (SH3 and multiple ankyrin repeat domains 3). |
Form : | Liquid |
Molecular Mass : | 15 kDa |
AA Sequence : | DTRHETREDRTKRLFRHYTVGSYDSLTSHSDYVIDDKVAILQKRDHEGFG FVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWRAGLRTGDFLIEV NGVNVVKVGHKQVVGLIRQGGNRLVMKVVSVTR |
Purity : | > 85 % SDS-PAGE. |
Applications : | SDS-PAGE |
Storage : | Shipped at 4 centigrade. Store at -20 centigrade or -80 centigrade. Avoid freeze / thaw cycle. |
Storage Buffer : | pH: 7.2. Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine). |
Gene Name | Shank3 SH3 and multiple ankyrin repeat domains 3 [ Mus musculus (house mouse) ] |
Official Symbol | SHANK3 |
Synonyms | Spank-2; proSAP2 |
Gene ID | 58234 |
mRNA Refseq | NM_021423.4 |
Protein Refseq | NP_067398.3 |
UniProt ID | Q4ACU6 |
◆ Recombinant Proteins | ||
SHANK3-301390H | Recombinant Human SHANK3 protein, GST-tagged | +Inquiry |
SHANK3-01M | Recombinant Mouse SHANK3 Protein, Flag-tagged | +Inquiry |
SHANK3-5387R | Recombinant Rat SHANK3 Protein | +Inquiry |
SHANK3-15086M | Recombinant Mouse SHANK3 Protein | +Inquiry |
SHANK3-5046R | Recombinant Rat SHANK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SHANK3 Products
Required fields are marked with *
My Review for All SHANK3 Products
Required fields are marked with *
0
Inquiry Basket