Recombinant Mouse SHH Protein

Cat.No. : SHH-241M
Product Overview : Recombinant Mouse SHH Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Sonic hedgehog (SHH) is a member of a small group of hedgehog secreted proteins that are essential for development in both vertebrates and invertebrates. There are three mammalian hedgehog homologues, sonic, desert, and indian, that signal via the Patched-1 and Patched-2 receptors. SHH is a morphogen that is essential during vertebrate organogenesis and adult stem cell division.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 19.8 kDa (176 aa)
AA Sequence : MIIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Shh sonic hedgehog [ Mus musculus (house mouse) ]
Official Symbol SHH
Synonyms SHH; sonic hedgehog; sonic hedgehog protein; HHG-1; short digits; hemimelic extra toes; Hx; Dsh; Hhg1; Hxl3; M100081; 9530036O11Rik;
Gene ID 20423
mRNA Refseq NM_009170
Protein Refseq NP_033196
UniProt ID Q62226

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SHH Products

Required fields are marked with *

My Review for All SHH Products

Required fields are marked with *

0
cart-icon