Recombinant Mouse Shh Protein, His-tagged

Cat.No. : Shh-7339M
Product Overview : Recombinant mouse SHH protein, fused to His-tag at C-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 25-198
Description : The C-terminal part of the sonic hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein into two parts (ShhN and ShhC) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated ShhN. Both activities occur in the reticulum endoplasmic. Once cleaved, ShhC is degraded in the endoplasmic reticulum.
Form : Liquid
Molecular Mass : 20.8 kDa
AA Sequence : MCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGLEHHHHHH
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol, 1 mM DTT
Gene Name Shh sonic hedgehog [ Mus musculus (house mouse) ]
Official Symbol Shh
Synonyms Shh; sonic hedgehog; Hx; Dsh; Hhg1; Hxl3; ShhNC; M100081; 9530036O11Rik; sonic hedgehog protein; HHG-1; hemimelic extra toes; shh unprocessed N-terminal signaling and C-terminal autoprocessing domains; short digits
Gene ID 20423
mRNA Refseq NM_009170
Protein Refseq NP_033196
UniProt ID Q62226

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Shh Products

Required fields are marked with *

My Review for All Shh Products

Required fields are marked with *

0
cart-icon