Recombinant Mouse Shh Protein, His-tagged

• Cat.No.: Shh-7339M
• Product Overview: Recombinant mouse SHH protein, fused to His-tag at C-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 25-198
• Description: The C-terminal part of the sonic hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein into two parts (ShhN and ShhC) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated ShhN. Both activities occur in the reticulum endoplasmic. Once cleaved, ShhC is degraded in the endoplasmic reticulum.
• Form: Liquid
• Molecular Mass: 20.8 kDa
• AA Sequence: MCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGLEHHHHHH
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
  Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol, 1 mM DTT

Gene Information

• Gene Name: Shh sonic hedgehog [ Mus musculus (house mouse) ]
• Official Symbol: Shh
• Synonyms: Shh; sonic hedgehog; Hx; Dsh; Hhg1; Hxl3; ShhNC; M100081; 9530036O11Rik; sonic hedgehog protein; HHG-1; hemimelic extra toes; shh unprocessed N-terminal signaling and C-terminal autoprocessing domains; short digits
• Gene ID: 20423
• mRNA Refseq: NM_009170
• Protein Refseq: NP_033196
• UniProt ID: Q62226