Recombinant Mouse Slamf6 Protein, His-tagged

• Cat.No.: Slamf6-144M
• Product Overview: Purified recombinant protein of Mouse SLAM family member 6 (Slamf6) with a N-His tag was expressed in HEK293 cell.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Description: Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2.
• Molecular Mass: 23.8 kDa
• AA Sequence: HHHHHHEVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVSVSTQSLCKGVLTNPPWN*
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: Slamf6 SLAM family member 6 [ Mus musculus (house mouse) ]
• Official Symbol: Slamf6
• Synonyms: Slamf6; SLAM family member 6; KAL1; NTBA; KAL1b; Ly108; NTB-A; SF2000; SLAM family member 6; lymphocyte antigen 108
• Gene ID: 30925
• mRNA Refseq: NM_030710
• Protein Refseq: NP_109635
• UniProt ID: Q9ET39