Recombinant Mouse SLC1A2 Protein (143-238 aa), GST-tagged
| Cat.No. : | SLC1A2-2332M |
| Product Overview : | Recombinant Mouse SLC1A2 Protein (143-238 aa) is produced by Yeast expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | GST |
| Protein Length : | 143-238 aa |
| Description : | Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly roving released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 37.6 kDa |
| AA Sequence : | HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Slc1a2 solute carrier family 1 (glial high affinity glutamate transporter), member 2 [ Mus musculus ] |
| Official Symbol | SLC1A2 |
| Synonyms | SLC1A2; GLT1; Eaat2; GLT-1; MGLT1; AI159670; 1700091C19Rik; 2900019G14Rik; |
| Gene ID | 20511 |
| mRNA Refseq | NM_001077514 |
| Protein Refseq | NP_001070982 |
| UniProt ID | P43006 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC1A2 Products
Required fields are marked with *
My Review for All SLC1A2 Products
Required fields are marked with *



