Recombinant Mouse SPAM1 Protein, Full Length
Cat.No. : | SPAM1-15816M |
Product Overview : | Recombinant Mouse SPAM1 Protein (Full Length) without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Protein Length : | Full Length |
Description : | Enables hyalurononglucosaminidase activity. Acts upstream of or within single fertilization. Located in acrosomal vesicle; external side of plasma membrane; and membrane raft. Orthologous to human SPAM1 (sperm adhesion molecule 1). |
Molecular Mass : | ~ 58 kDa |
AA Sequence : | MGELRFKHLFWGSFVESGGTFQTVLIFLLIPCSLTVDYRAAPILSNTTFLWIWNVPTERCVGNVNDPIDLSFFSLIGSPRKTATGQPVTLFYVDRLGLYPHIDANQAEHYGGIPQRGDYQAHLRKAKTDIEHYIPDDKLGLAIIDWEEWRPTWLRNWKPKDNYRNKSIELVQSTNPGLSITEATQKAIQQFEEAGRKFMEGTLHLGKFLRPNQLWGYYLFPDCYNNKFQDPKYDGQCPAVEKKRNDNLKWLWKASTGLYPSVYLKKDLKSNRQATLYVRYRVVEAIRVSKVGNASDPVPIFVYIRLVFTDRTSEYLLEDDLVNTIGEIVALGTSGIIIWDAMSLAQRAAGCPILHKYMQTTLNPYIVNVTLAAKMCSQTLCNEKGMCSRRKESSDVYLHLNPSHFDIMLTETGKYEVLGNPRVGDLEYFSEHFKCSCFSRMTCKETSDVKNVQDVNVCVGDNVCIKAKVEPNPAFYLLPGKSLLFMTTLGHVLYHLPQDIFVFPRKTLVSTP |
Endotoxin : | < 1 EU/μg protein by LAL |
Purity : | > 85% as determined by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.3 mg/mL |
Storage Buffer : | Supplied as a 0.2 μm filtered solution in PBS (pH 7.4) |
Gene Name | Spam1 sperm adhesion molecule 1 [ Mus musculus (house mouse) ] |
Official Symbol | SPAM1 |
Synonyms | SPAM1; sperm adhesion molecule 1; hyaluronidase PH-20; hyal-PH20; sperm surface protein PH-20; hyaluronoglucosaminidase PH-20; Ph-20; AV039194 |
Gene ID | 20690 |
mRNA Refseq | NM_001079875 |
Protein Refseq | NP_001073344 |
UniProt ID | P48794 |
◆ Recombinant Proteins | ||
SPAM1-1383H | Recombinant Human SPAM1 protein, His-tagged | +Inquiry |
TNFSF11-313H | Recombinant Human Sperm Adhesion Molecule 1 (PH-20 Hyaluronidase, Zona Pellucida Binding), His-Fc-Tagged | +Inquiry |
SPAM1-738H | Active Recombinant Human SPAM1 protein, His-tagged | +Inquiry |
SPAM1-5341R | Recombinant Rat SPAM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPAM1-6340H | Recombinant Human SPAM1 Protein (Leu36-Ser490), C-His tagged | +Inquiry |
◆ Native Proteins | ||
Hyaluronidase-35O | Active Native Ovine Hyaluronidase, 300U/mg | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPAM1-1546HCL | Recombinant Human SPAM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPAM1 Products
Required fields are marked with *
My Review for All SPAM1 Products
Required fields are marked with *