Recombinant Mouse SPAM1 Protein, Full Length
| Cat.No. : | SPAM1-15816M |
| Product Overview : | Recombinant Mouse SPAM1 Protein (Full Length) without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Protein Length : | Full Length |
| Description : | Enables hyalurononglucosaminidase activity. Acts upstream of or within single fertilization. Located in acrosomal vesicle; external side of plasma membrane; and membrane raft. Orthologous to human SPAM1 (sperm adhesion molecule 1). |
| Molecular Mass : | ~ 58 kDa |
| AA Sequence : | MGELRFKHLFWGSFVESGGTFQTVLIFLLIPCSLTVDYRAAPILSNTTFLWIWNVPTERCVGNVNDPIDLSFFSLIGSPRKTATGQPVTLFYVDRLGLYPHIDANQAEHYGGIPQRGDYQAHLRKAKTDIEHYIPDDKLGLAIIDWEEWRPTWLRNWKPKDNYRNKSIELVQSTNPGLSITEATQKAIQQFEEAGRKFMEGTLHLGKFLRPNQLWGYYLFPDCYNNKFQDPKYDGQCPAVEKKRNDNLKWLWKASTGLYPSVYLKKDLKSNRQATLYVRYRVVEAIRVSKVGNASDPVPIFVYIRLVFTDRTSEYLLEDDLVNTIGEIVALGTSGIIIWDAMSLAQRAAGCPILHKYMQTTLNPYIVNVTLAAKMCSQTLCNEKGMCSRRKESSDVYLHLNPSHFDIMLTETGKYEVLGNPRVGDLEYFSEHFKCSCFSRMTCKETSDVKNVQDVNVCVGDNVCIKAKVEPNPAFYLLPGKSLLFMTTLGHVLYHLPQDIFVFPRKTLVSTP |
| Endotoxin : | < 1 EU/μg protein by LAL |
| Purity : | > 85% as determined by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.3 mg/mL |
| Storage Buffer : | Supplied as a 0.2 μm filtered solution in PBS (pH 7.4) |
| Gene Name | Spam1 sperm adhesion molecule 1 [ Mus musculus (house mouse) ] |
| Official Symbol | SPAM1 |
| Synonyms | SPAM1; sperm adhesion molecule 1; hyaluronidase PH-20; hyal-PH20; sperm surface protein PH-20; hyaluronoglucosaminidase PH-20; Ph-20; AV039194 |
| Gene ID | 20690 |
| mRNA Refseq | NM_001079875 |
| Protein Refseq | NP_001073344 |
| UniProt ID | P48794 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPAM1 Products
Required fields are marked with *
My Review for All SPAM1 Products
Required fields are marked with *
