Recombinant Mouse SPAM1 Protein, Full Length

Cat.No. : SPAM1-15816M
Product Overview : Recombinant Mouse SPAM1 Protein (Full Length) without tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Protein Length : Full Length
Description : Enables hyalurononglucosaminidase activity. Acts upstream of or within single fertilization. Located in acrosomal vesicle; external side of plasma membrane; and membrane raft. Orthologous to human SPAM1 (sperm adhesion molecule 1).
Molecular Mass : ~ 58 kDa
AA Sequence : MGELRFKHLFWGSFVESGGTFQTVLIFLLIPCSLTVDYRAAPILSNTTFLWIWNVPTERCVGNVNDPIDLSFFSLIGSPRKTATGQPVTLFYVDRLGLYPHIDANQAEHYGGIPQRGDYQAHLRKAKTDIEHYIPDDKLGLAIIDWEEWRPTWLRNWKPKDNYRNKSIELVQSTNPGLSITEATQKAIQQFEEAGRKFMEGTLHLGKFLRPNQLWGYYLFPDCYNNKFQDPKYDGQCPAVEKKRNDNLKWLWKASTGLYPSVYLKKDLKSNRQATLYVRYRVVEAIRVSKVGNASDPVPIFVYIRLVFTDRTSEYLLEDDLVNTIGEIVALGTSGIIIWDAMSLAQRAAGCPILHKYMQTTLNPYIVNVTLAAKMCSQTLCNEKGMCSRRKESSDVYLHLNPSHFDIMLTETGKYEVLGNPRVGDLEYFSEHFKCSCFSRMTCKETSDVKNVQDVNVCVGDNVCIKAKVEPNPAFYLLPGKSLLFMTTLGHVLYHLPQDIFVFPRKTLVSTP
Endotoxin : < 1 EU/μg protein by LAL
Purity : > 85% as determined by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.3 mg/mL
Storage Buffer : Supplied as a 0.2 μm filtered solution in PBS (pH 7.4)
Gene Name Spam1 sperm adhesion molecule 1 [ Mus musculus (house mouse) ]
Official Symbol SPAM1
Synonyms SPAM1; sperm adhesion molecule 1; hyaluronidase PH-20; hyal-PH20; sperm surface protein PH-20; hyaluronoglucosaminidase PH-20; Ph-20; AV039194
Gene ID 20690
mRNA Refseq NM_001079875
Protein Refseq NP_001073344
UniProt ID P48794

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPAM1 Products

Required fields are marked with *

My Review for All SPAM1 Products

Required fields are marked with *

0
cart-icon