Recombinant Mouse SPINK2 Protein (17-86 aa), His-Myc-tagged

• Cat.No.: SPINK2-2533M
• Product Overview: Recombinant Mouse SPINK2 Protein (17-86 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 17-86 aa
• Description: Inhibits trypsin in a dose-dependent manner. Required for maintenance of normal spermatogenesis. May be involved in regulating serine protease-dependent germ cell apoptosis.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 15.0 kDa
• AA Sequence: HETLDSSDSQIMKRSQFRTPDCGHFDFPACPRNLNPVCGTDMNTYSNECTLCMKIREDGSHINIIKDEPC
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Spink2 serine peptidase inhibitor, Kazal type 2 [ Mus musculus (house mouse) ]
• Official Symbol: SPINK2
• Synonyms: Spink2; HUSI-II; AV038945; 1700007F22Rik
• Gene ID: 69982
• mRNA Refseq: NM_001289768
• Protein Refseq: NP_001276697
• UniProt ID: Q8BMY7