Recombinant Mouse SPINK2 Protein (17-86 aa), His-Myc-tagged
Cat.No. : | SPINK2-2533M |
Product Overview : | Recombinant Mouse SPINK2 Protein (17-86 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 17-86 aa |
Description : | Inhibits trypsin in a dose-dependent manner. Required for maintenance of normal spermatogenesis. May be involved in regulating serine protease-dependent germ cell apoptosis. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 15.0 kDa |
AA Sequence : | HETLDSSDSQIMKRSQFRTPDCGHFDFPACPRNLNPVCGTDMNTYSNECTLCMKIREDGSHINIIKDEPC |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Spink2 serine peptidase inhibitor, Kazal type 2 [ Mus musculus (house mouse) ] |
Official Symbol | SPINK2 |
Synonyms | Spink2; HUSI-II; AV038945; 1700007F22Rik; |
Gene ID | 69982 |
mRNA Refseq | NM_001289768 |
Protein Refseq | NP_001276697 |
UniProt ID | Q8BMY7 |
◆ Recombinant Proteins | ||
SPINK2-562H | Recombinant Human SPINK2 Protein, Fc-tagged | +Inquiry |
SPINK2-5713R | Recombinant Rat SPINK2 Protein | +Inquiry |
SPINK2-15890M | Recombinant Mouse SPINK2 Protein | +Inquiry |
SPINK2-5372R | Recombinant Rat SPINK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPINK2-2533M | Recombinant Mouse SPINK2 Protein (17-86 aa), His-Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPINK2-1510HCL | Recombinant Human SPINK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPINK2 Products
Required fields are marked with *
My Review for All SPINK2 Products
Required fields are marked with *