Recombinant Mouse Srpx2 Protein, His-SUMO/MYC-tagged
| Cat.No. : | Srpx2-1376M |
| Product Overview : | Recombinant Mouse Srpx2 Protein (26-468aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 26-468 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 70.5 kDa |
| AA Sequence : | WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLTCSSAGDNYGAICEYHCDGGYERQGTPSRVCQSSRQWSGTPPVCTPMKINVNVNSAAGLLDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLIDKQGIDRERYMEPVTPEEIFTFIDDYLLSNEELARRVEQRDLCE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Srpx2 sushi-repeat-containing protein, X-linked 2 [ Mus musculus (house mouse) ] |
| Official Symbol | Srpx2 |
| Synonyms | SRP; SRPUL; 1110039C07Rik; Srpx2 |
| Gene ID | 68792 |
| mRNA Refseq | NM_026838.4 |
| Protein Refseq | NP_081114.2 |
| UniProt ID | Q8R054 |
| ◆ Recombinant Proteins | ||
| Srpx2-1376M | Recombinant Mouse Srpx2 Protein, His-SUMO/MYC-tagged | +Inquiry |
| SRPX2-2759M | Recombinant Mouse SRPX2 Protein (26-468 aa), His-Myc-tagged | +Inquiry |
| SRPX2-8123HFL | Recombinant Full Length Human SRPX2 protein, Flag-tagged | +Inquiry |
| SRPX2-5745R | Recombinant Rat SRPX2 Protein | +Inquiry |
| SRPX2-702HF | Recombinant Full Length Human SRPX2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SRPX2-1471HCL | Recombinant Human SRPX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Srpx2 Products
Required fields are marked with *
My Review for All Srpx2 Products
Required fields are marked with *
