Recombinant Mouse Stc2 protein
| Cat.No. : | Stc2-4574M |
| Product Overview : | Recombinant Mouse Stc2 protein(O88452)(25-296aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 25-296aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.1 kDa |
| AA Sequence : | TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Stc2 stanniocalcin 2 [ Mus musculus ] |
| Official Symbol | Stc2 |
| Synonyms | STC2; stanniocalcin 2; stanniocalcin-2; STC-2; Stc2l; mustc2; AW125853; |
| Gene ID | 20856 |
| mRNA Refseq | NM_011491 |
| Protein Refseq | NP_035621 |
| ◆ Recombinant Proteins | ||
| STC2-8603H | Recombinant Human STC2, Fc tagged | +Inquiry |
| STC2-3028H | Recombinant Human STC2 protein, His-tagged | +Inquiry |
| STC2-5784R | Recombinant Rat STC2 Protein | +Inquiry |
| STC2-313H | Recombinant Human STC2 protein, GST-tagged | +Inquiry |
| STC2-142H | Recombinant Human Stanniocalcin 2, Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STC2-849HCL | Recombinant Human STC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Stc2 Products
Required fields are marked with *
My Review for All Stc2 Products
Required fields are marked with *
