Recombinant Mouse Stim1 protein
| Cat.No. : | Stim1-5131M |
| Product Overview : | Recombinant Mouse Stim1 protein(P70302)(23-213 aa) was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Mammalian cells |
| Tag : | Non |
| Protein Length : | 23-213 aa |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | LSHSHSEKNTGASSGATSEESTEAEFCRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGD VDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVIQWLI TYVELPQYEETFRKLQLTGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGP PLLTRHNHLKD |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Stim1 stromal interaction molecule 1 [ Mus musculus ] |
| Official Symbol | Stim1 |
| Synonyms | STIM1; stromal interaction molecule 1; SIM; |
| Gene ID | 20866 |
| mRNA Refseq | NM_009287 |
| Protein Refseq | NP_033313 |
| ◆ Recombinant Proteins | ||
| STIM1-0415H | Recombinant Human STIM1 protein, His-tagged | +Inquiry |
| Stim1-5128M | Recombinant Mouse Stim1 protein | +Inquiry |
| STIM1-6371H | Recombinant Human STIM1 Protein (Ser28-Leu211), N-His tagged | +Inquiry |
| STIM1-344H | Recombinant Human Stromal Interaction Molecule 1, CaM-tagged | +Inquiry |
| STIM1-5788R | Recombinant Rat STIM1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STIM1-2277HCL | Recombinant Human STIM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Stim1 Products
Required fields are marked with *
My Review for All Stim1 Products
Required fields are marked with *
