Recombinant Mouse Sult1a1 protein, His&Myc-tagged
Cat.No. : | Sult1a1-3543M |
Product Overview : | Recombinant Mouse Sult1a1 protein(P52840)(1-291aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-291aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39 kDa |
AA Sequence : | MEPLRKPLVPVKGIPLIKYFAETMEQLQNFTAWPDDVLISTYPKSGTNWMSEIMDMIYQGGKLDKCGRAPVYARIPFLEFSCPGVPPGLETLKETPAPRIIKTHLPLSLLPQSLLDQKIKVIYVARNAKDVVVSYYNFYKMAKLHPDPGTWESFLENFMDGKVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREIKKILEFLGRSLPEETVDLIVHHTSFKKMKENPMANYTTIPTEVMDHTIYPFMRKGTIGDWKNTFTVAQSEHFDAHYAKLMTGCDFTFRCQI |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Sult1a1 sulfotransferase family 1A, phenol-preferring, member 1 [ Mus musculus ] |
Official Symbol | Sult1a1 |
Synonyms | SULT1A1; sulfotransferase family 1A, phenol-preferring, member 1; sulfotransferase 1A1; ST1A4; mSTp1; sulfokinase; aryl sulfotransferase; phenol sulfotransferase; arylsulfotransferase ST1A4; phenol/aryl sulfotransferase; sulfotransferase, phenol preferring 1; PST; Stp; Stp1; ST1A1; AI266890; |
Gene ID | 20887 |
mRNA Refseq | NM_133670 |
Protein Refseq | NP_598431 |
◆ Recombinant Proteins | ||
Sult1a1-1379R | Recombinant Rat Sult1a1 Protein, His-SUMO/MYC-tagged | +Inquiry |
Sult1a1-6749M | Recombinant Mouse Sult1a1 protein, His & T7-tagged | +Inquiry |
SULT1A1-2830H | Recombinant Human SULT1A1 protein, His-tagged | +Inquiry |
SULT1A1-3921H | Recombinant Human SULT1A1 protein(Glu2-Leu295), His-tagged | +Inquiry |
SULT1A1-2012H | Recombinant Human SULT1A1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SULT1A1-1357HCL | Recombinant Human SULT1A1 293 Cell Lysate | +Inquiry |
SULT1A1-1356HCL | Recombinant Human SULT1A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sult1a1 Products
Required fields are marked with *
My Review for All Sult1a1 Products
Required fields are marked with *
0
Inquiry Basket