Recombinant Mouse Sult1a1 protein, His-SUMO & Myc-tagged

Cat.No. : Sult1a1-3542M
Product Overview : Recombinant Mouse Sult1a1 protein(P52840)(1-291aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 1-291aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 54 kDa
AA Sequence : MEPLRKPLVPVKGIPLIKYFAETMEQLQNFTAWPDDVLISTYPKSGTNWMSEIMDMIYQGGKLDKCGRAPVYARIPFLEFSCPGVPPGLETLKETPAPRIIKTHLPLSLLPQSLLDQKIKVIYVARNAKDVVVSYYNFYKMAKLHPDPGTWESFLENFMDGKVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREIKKILEFLGRSLPEETVDLIVHHTSFKKMKENPMANYTTIPTEVMDHTIYPFMRKGTIGDWKNTFTVAQSEHFDAHYAKLMTGCDFTFRCQI
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Sult1a1 sulfotransferase family 1A, phenol-preferring, member 1 [ Mus musculus ]
Official Symbol Sult1a1
Synonyms SULT1A1; sulfotransferase family 1A, phenol-preferring, member 1; sulfotransferase 1A1; ST1A4; mSTp1; sulfokinase; aryl sulfotransferase; phenol sulfotransferase; arylsulfotransferase ST1A4; phenol/aryl sulfotransferase; sulfotransferase, phenol preferring 1; PST; Stp; Stp1; ST1A1; AI266890;
Gene ID 20887
mRNA Refseq NM_133670
Protein Refseq NP_598431

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Sult1a1 Products

Required fields are marked with *

My Review for All Sult1a1 Products

Required fields are marked with *

0
cart-icon