Recombinant Mouse Sycp3 protein
| Cat.No. : | Sycp3-4855M |
| Product Overview : | Recombinant Mouse Sycp3 protein(P70281)(1-254 aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 1-254 aa |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | MLRGCGDSDSSPEPLSKHLKMVPGGRKHSGKSGKPPLVDQPKKAFDFEKDDKDLSGSEED VADEKAPVIDKHGKKRSAGIIEDVGGEVQNMLEKFGADINKALLAKRKRIEMYTKASFKA SNQKIEQIWKTQQEEIQKLNNEYSQQFMNVLQQWELDIQKFEEQGEKLSNLFRQQQKIFQ QSRIVQSQRMFAMKQIHEQFIKSLEDVEKNNDNLFTGTQSELKKEMAMLQKKVMMETQQQ EMANVRKSLQSMLF |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | Sycp3 synaptonemal complex protein 3 [ Mus musculus ] |
| Official Symbol | Sycp3 |
| Synonyms | SYCP3; synaptonemal complex protein 3; SCP-3; Cor1; Scp3; |
| Gene ID | 20962 |
| mRNA Refseq | NM_011517 |
| Protein Refseq | NP_035647 |
| ◆ Recombinant Proteins | ||
| Sycp3-4858M | Recombinant Mouse Sycp3 protein | +Inquiry |
| Sycp3-4855M | Recombinant Mouse Sycp3 protein | +Inquiry |
| SYCP3-995C | Recombinant Cynomolgus SYCP3 Protein, His-tagged | +Inquiry |
| Sycp3-4857M | Recombinant Mouse Sycp3 protein | +Inquiry |
| SYCP3-12HFL | Recombinant Full Length Human synaptonemal complex protein 3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SYCP3-1322HCL | Recombinant Human SYCP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sycp3 Products
Required fields are marked with *
My Review for All Sycp3 Products
Required fields are marked with *
