Recombinant Mouse Terf1 protein
Cat.No. : | Terf1-4883M |
Product Overview : | Recombinant Mouse Terf1 protein(P70371)(2-421 aa) was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | Non |
Protein Length : | 2-421 aa |
Form : | Tris/PBS-based buffer, 6% Trehalose. |
AASequence : | AETVSSAARDAPSREGWTDSDSPEQEEVGDDAELLQCQLQLGTPREMENAELVAEVEAVA AGWMLDFLCLSLCRAFRDGRSEDFRRTRDSAEAIIHGLHRLTAYQLKTVYICQFLTRVAS GKALDAQFEVDERITPLESALMIWNSIEKEHDKLHDEIKNLIKIQAVAVCMEIGSFKEAE EVFERIFGDPEFYTPLERKLLKIISQKDVFHSLFQHFSYSCMMEKIQSYVGDVLSEKSST FLMKAATKVVENEKARTQASKDRPDATNTGMDTEVGLNKEKSVNGQQSTETEPLVDTVSS IRSHKNALSQLKHRRAPSDFSRNEARTGTLQCETTMERNRRTSGRNRLCVSENQPDTDDK SGRRKRQTWLWEEDRILKCGVKKYGEGNWAKILSHYKFNNRTSVMLKDRWRTMKRLKLIS |
Purity : | >85% (SDS-PAGE) |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | Terf1 telomeric repeat binding factor 1 [ Mus musculus ] |
Official Symbol | Terf1 |
Synonyms | TERF1; telomeric repeat binding factor 1; telomeric repeat-binding factor 1; TTAGGG repeat-binding factor 1; Pin2; Trf1; Trbf1; |
Gene ID | 21749 |
mRNA Refseq | NM_009352 |
Protein Refseq | NP_033378 |
◆ Recombinant Proteins | ||
TERF1-30122TH | Recombinant Human TERF1, His-tagged | +Inquiry |
Terf1-4886M | Recombinant Mouse Terf1 protein | +Inquiry |
TERF1-002H | Recombinant Human TERF1 Protein, His-tagged | +Inquiry |
TERF1-3059H | Recombinant Human TERF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Terf1-4884M | Recombinant Mouse Terf1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TERF1-528HCL | Recombinant Human TERF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Terf1 Products
Required fields are marked with *
My Review for All Terf1 Products
Required fields are marked with *