Recombinant Mouse Terf1 protein, Avi-tagged, Biotinylated
| Cat.No. : | Terf1-4885M |
| Product Overview : | Biotinylated Recombinant Mouse Terf1 protein(P70371)(2-421 aa), fused with Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Avi |
| Protein Length : | 2-421 aa |
| Conjugation/Label : | Biotin |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | AETVSSAARDAPSREGWTDSDSPEQEEVGDDAELLQCQLQLGTPREMENAELVAEVEAVA AGWMLDFLCLSLCRAFRDGRSEDFRRTRDSAEAIIHGLHRLTAYQLKTVYICQFLTRVAS GKALDAQFEVDERITPLESALMIWNSIEKEHDKLHDEIKNLIKIQAVAVCMEIGSFKEAE EVFERIFGDPEFYTPLERKLLKIISQKDVFHSLFQHFSYSCMMEKIQSYVGDVLSEKSST FLMKAATKVVENEKARTQASKDRPDATNTGMDTEVGLNKEKSVNGQQSTETEPLVDTVSS IRSHKNALSQLKHRRAPSDFSRNEARTGTLQCETTMERNRRTSGRNRLCVSENQPDTDDK SGRRKRQTWLWEEDRILKCGVKKYGEGNWAKILSHYKFNNRTSVMLKDRWRTMKRLKLIS |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Conjugation : | Biotin |
| Gene Name | Terf1 telomeric repeat binding factor 1 [ Mus musculus ] |
| Official Symbol | Terf1 |
| Synonyms | TERF1; telomeric repeat binding factor 1; telomeric repeat-binding factor 1; TTAGGG repeat-binding factor 1; Pin2; Trf1; Trbf1; |
| Gene ID | 21749 |
| mRNA Refseq | NM_009352 |
| Protein Refseq | NP_033378 |
| ◆ Recombinant Proteins | ||
| TERF1-5950C | Recombinant Chicken TERF1 | +Inquiry |
| TERF1-9129M | Recombinant Mouse TERF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TERF1-002H | Recombinant Human TERF1 Protein, His-tagged | +Inquiry |
| Terf1-4884M | Recombinant Mouse Terf1 protein | +Inquiry |
| TERF1-5250H | Recombinant Human TERF1 Protein, GST/His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TERF1-528HCL | Recombinant Human TERF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Terf1 Products
Required fields are marked with *
My Review for All Terf1 Products
Required fields are marked with *
