Recombinant Mouse Terf1 protein, Avi-tagged, Biotinylated
| Cat.No. : | Terf1-4885M | 
| Product Overview : | Biotinylated Recombinant Mouse Terf1 protein(P70371)(2-421 aa), fused with Avi tag, was expressed in E.coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Mouse | 
| Source : | E.coli | 
| Tag : | Avi | 
| Protein Length : | 2-421 aa | 
| Conjugation/Label : | Biotin | 
| Form : | Tris/PBS-based buffer, 6% Trehalose. | 
| AASequence : | AETVSSAARDAPSREGWTDSDSPEQEEVGDDAELLQCQLQLGTPREMENAELVAEVEAVA AGWMLDFLCLSLCRAFRDGRSEDFRRTRDSAEAIIHGLHRLTAYQLKTVYICQFLTRVAS GKALDAQFEVDERITPLESALMIWNSIEKEHDKLHDEIKNLIKIQAVAVCMEIGSFKEAE EVFERIFGDPEFYTPLERKLLKIISQKDVFHSLFQHFSYSCMMEKIQSYVGDVLSEKSST FLMKAATKVVENEKARTQASKDRPDATNTGMDTEVGLNKEKSVNGQQSTETEPLVDTVSS IRSHKNALSQLKHRRAPSDFSRNEARTGTLQCETTMERNRRTSGRNRLCVSENQPDTDDK SGRRKRQTWLWEEDRILKCGVKKYGEGNWAKILSHYKFNNRTSVMLKDRWRTMKRLKLIS | 
| Purity : | >85% (SDS-PAGE) | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. | 
| Conjugation : | Biotin | 
| Gene Name | Terf1 telomeric repeat binding factor 1 [ Mus musculus ] | 
| Official Symbol | Terf1 | 
| Synonyms | TERF1; telomeric repeat binding factor 1; telomeric repeat-binding factor 1; TTAGGG repeat-binding factor 1; Pin2; Trf1; Trbf1; | 
| Gene ID | 21749 | 
| mRNA Refseq | NM_009352 | 
| Protein Refseq | NP_033378 | 
| ◆ Recombinant Proteins | ||
| Terf1-4885M | Recombinant Mouse Terf1 protein, Avi-tagged, Biotinylated | +Inquiry | 
| TERF1-30122TH | Recombinant Human TERF1, His-tagged | +Inquiry | 
| Terf1-4887M | Recombinant Mouse Terf1 protein | +Inquiry | 
| TERF1-002H | Recombinant Human TERF1 Protein, His-tagged | +Inquiry | 
| TERF1-16643M | Recombinant Mouse TERF1 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| TERF1-528HCL | Recombinant Human TERF1 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All Terf1 Products
Required fields are marked with *
My Review for All Terf1 Products
Required fields are marked with *
  
        
    
      
            