Recombinant Mouse Tff2 protein, His-tagged

Cat.No. : Tff2-01M
Product Overview : Recombinant Mouse Tff2 fused with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Form : 20mM Tris-HCl, pH 8.0, 100mM NaCl.
Molecular Mass : (Theoretical molecular weight)~13kDa including His tag.
AA Sequence : MNHKVHHHHHHMEKPSPCRCSRLTPHNRKNCGFPGITSEQCFDLGCCFDSSVAGVPWCFHPLPNQESEQCVMEVSARKNCGYPGISPEDCASRNCCFSNLIFEVPWCFFPQSVEDCHY
Purity : > 90% as determined by SDS-PAGE
Storage : Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.51 mg/ml
Gene Name Tff2 trefoil factor 2 (spasmolytic protein 1) [ Mus musculus ]
Official Symbol Tff2
Synonyms TFF2; trefoil factor 2 (spasmolytic protein 1); trefoil factor 2; spasmolytic polypeptide; SP; mSP;
Gene ID 21785
mRNA Refseq NM_009363
Protein Refseq NP_033389
UniProt ID Q9QX97
Chromosome Location 17 A3.3; 17 15.8 cM
Function CXCR4 chemokine receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tff2 Products

Required fields are marked with *

My Review for All Tff2 Products

Required fields are marked with *

0
cart-icon