Recombinant Mouse Tff2 protein, His-tagged
| Cat.No. : | Tff2-01M |
| Product Overview : | Recombinant Mouse Tff2 fused with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Form : | 20mM Tris-HCl, pH 8.0, 100mM NaCl. |
| Molecular Mass : | (Theoretical molecular weight)~13kDa including His tag. |
| AA Sequence : | MNHKVHHHHHHMEKPSPCRCSRLTPHNRKNCGFPGITSEQCFDLGCCFDSSVAGVPWCFHPLPNQESEQCVMEVSARKNCGYPGISPEDCASRNCCFSNLIFEVPWCFFPQSVEDCHY |
| Purity : | > 90% as determined by SDS-PAGE |
| Storage : | Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 0.51 mg/ml |
| Gene Name | Tff2 trefoil factor 2 (spasmolytic protein 1) [ Mus musculus ] |
| Official Symbol | Tff2 |
| Synonyms | TFF2; trefoil factor 2 (spasmolytic protein 1); trefoil factor 2; spasmolytic polypeptide; SP; mSP; |
| Gene ID | 21785 |
| mRNA Refseq | NM_009363 |
| Protein Refseq | NP_033389 |
| UniProt ID | Q9QX97 |
| Chromosome Location | 17 A3.3; 17 15.8 cM |
| Function | CXCR4 chemokine receptor binding; |
| ◆ Recombinant Proteins | ||
| TFF2-30657TH | Active Recombinant Human TFF2 protein, Tag Free | +Inquiry |
| TFF2-5688R | Recombinant Rat TFF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TFF2-6029R | Recombinant Rat TFF2 Protein | +Inquiry |
| TFF2-1045H | Recombinant Human TFF2,His-tagged | +Inquiry |
| Tff2-835R | Recombinant Rat Tff2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TFF2-1126HCL | Recombinant Human TFF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tff2 Products
Required fields are marked with *
My Review for All Tff2 Products
Required fields are marked with *
