Recombinant Mouse Tff2 protein, His-tagged
Cat.No. : | Tff2-01M |
Product Overview : | Recombinant Mouse Tff2 fused with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Form : | 20mM Tris-HCl, pH 8.0, 100mM NaCl. |
Molecular Mass : | (Theoretical molecular weight)~13kDa including His tag. |
AA Sequence : | MNHKVHHHHHHMEKPSPCRCSRLTPHNRKNCGFPGITSEQCFDLGCCFDSSVAGVPWCFHPLPNQESEQCVMEVSARKNCGYPGISPEDCASRNCCFSNLIFEVPWCFFPQSVEDCHY |
Purity : | > 90% as determined by SDS-PAGE |
Storage : | Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.51 mg/ml |
Gene Name | Tff2 trefoil factor 2 (spasmolytic protein 1) [ Mus musculus ] |
Official Symbol | Tff2 |
Synonyms | TFF2; trefoil factor 2 (spasmolytic protein 1); trefoil factor 2; spasmolytic polypeptide; SP; mSP; |
Gene ID | 21785 |
mRNA Refseq | NM_009363 |
Protein Refseq | NP_033389 |
UniProt ID | Q9QX97 |
Chromosome Location | 17 A3.3; 17 15.8 cM |
Function | CXCR4 chemokine receptor binding; |
◆ Recombinant Proteins | ||
TFF2-6029R | Recombinant Rat TFF2 Protein | +Inquiry |
Tff2-01M | Recombinant Mouse Tff2 protein, His-tagged | +Inquiry |
TFF2-30657TH | Active Recombinant Human TFF2 protein, Tag Free | +Inquiry |
Tff2-6380M | Recombinant Mouse Tff2 Protein, Myc/DDK-tagged | +Inquiry |
TFF2-6419H | Recombinant Human TFF2 Protein (Gln24-Tyr129), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFF2-1126HCL | Recombinant Human TFF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tff2 Products
Required fields are marked with *
My Review for All Tff2 Products
Required fields are marked with *
0
Inquiry Basket