Recombinant Mouse Thy1 protein, His-SUMO-tagged
Cat.No. : | Thy1-3580M |
Product Overview : | Recombinant Mouse Thy1 protein(P01831)(20-131aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
Availability | October 19, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 20-131aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.8 kDa |
AA Sequence : | QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Thy1 thymus cell antigen 1, theta [ Mus musculus ] |
Official Symbol | Thy1 |
Synonyms | THY1; thymus cell antigen 1, theta; thy-1 membrane glycoprotein; Thy 1.2; thy-1 antigen; T25; CD90; Thy-1; Thy1.1; Thy1.2; Thy-1.2; |
Gene ID | 21838 |
mRNA Refseq | NM_009382 |
Protein Refseq | NP_033408 |
◆ Recombinant Proteins | ||
THY1-3228H | Recombinant Human THY1, His-tagged | +Inquiry |
THY1-139H | Recombinant Human THY1 Protein, His-tagged | +Inquiry |
THY1-5131H | Recombinant Human THY1 Protein (Met1-Cys130), C-His tagged | +Inquiry |
THY1-3755H | Recombinant Human THY1 protein, rFc-tagged | +Inquiry |
Thy1-3580M | Recombinant Mouse Thy1 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
THY1-952CCL | Recombinant Cynomolgus THY1 cell lysate | +Inquiry |
THY1-2384MCL | Recombinant Mouse THY1 cell lysate | +Inquiry |
THY1-1297RCL | Recombinant Rat THY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Thy1 Products
Required fields are marked with *
My Review for All Thy1 Products
Required fields are marked with *