Recombinant Mouse Thy1 protein, His-SUMO-tagged
| Cat.No. : | Thy1-3580M |
| Product Overview : | Recombinant Mouse Thy1 protein(P01831)(20-131aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
| Availability | January 11, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 20-131aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.8 kDa |
| AA Sequence : | QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Thy1 thymus cell antigen 1, theta [ Mus musculus ] |
| Official Symbol | Thy1 |
| Synonyms | THY1; thymus cell antigen 1, theta; thy-1 membrane glycoprotein; Thy 1.2; thy-1 antigen; T25; CD90; Thy-1; Thy1.1; Thy1.2; Thy-1.2; |
| Gene ID | 21838 |
| mRNA Refseq | NM_009382 |
| Protein Refseq | NP_033408 |
| ◆ Recombinant Proteins | ||
| THY1-542H | Recombinant Human Thy1 Protein | +Inquiry |
| THY1-586H | Active Recombinant Human THY1, Fc-tagged | +Inquiry |
| THY1-3229H | Recombinant Human THY1 protein, His-tagged | +Inquiry |
| THY1-3228H | Recombinant Human THY1, His-tagged | +Inquiry |
| THY1-104C | Recombinant Cynomolgus THY1, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| THY1-952CCL | Recombinant Cynomolgus THY1 cell lysate | +Inquiry |
| THY1-2384MCL | Recombinant Mouse THY1 cell lysate | +Inquiry |
| THY1-1297RCL | Recombinant Rat THY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Thy1 Products
Required fields are marked with *
My Review for All Thy1 Products
Required fields are marked with *
