Recombinant Mouse Thy1 protein, His-SUMO-tagged

Cat.No. : Thy1-3580M
Product Overview : Recombinant Mouse Thy1 protein(P01831)(20-131aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 20-131aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 28.8 kDa
AA Sequence : QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Thy1 thymus cell antigen 1, theta [ Mus musculus ]
Official Symbol Thy1
Synonyms THY1; thymus cell antigen 1, theta; thy-1 membrane glycoprotein; Thy 1.2; thy-1 antigen; T25; CD90; Thy-1; Thy1.1; Thy1.2; Thy-1.2;
Gene ID 21838
mRNA Refseq NM_009382
Protein Refseq NP_033408

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Thy1 Products

Required fields are marked with *

My Review for All Thy1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon