Recombinant Mouse Tll1 protein, His-tagged
Cat.No. : | Tll1-743M |
Product Overview : | Recombinant Mouse Tll1 protein(Q62381)(148-347aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 148-347a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | AATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFTERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCP |
Gene Name | Tll1 tolloid-like [ Mus musculus ] |
Official Symbol | Tll1 |
Synonyms | TLL1; tolloid-like; tolloid-like protein 1; mTll; Tll; Tll-1; |
Gene ID | 21892 |
mRNA Refseq | NM_009390 |
Protein Refseq | NP_033416 |
◆ Recombinant Proteins | ||
TLL1-1110H | Recombinant Human TLL1 Protein, MYC/DDK-tagged | +Inquiry |
TLL1-3254H | Recombinant Human TLL1, His-tagged | +Inquiry |
Tll1-743M | Recombinant Mouse Tll1 protein, His-tagged | +Inquiry |
TLL1-8641Z | Recombinant Zebrafish TLL1 | +Inquiry |
Tll1-6451M | Recombinant Mouse Tll1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLL1-1786HCL | Recombinant Human TLL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tll1 Products
Required fields are marked with *
My Review for All Tll1 Products
Required fields are marked with *