Recombinant Mouse TMPRSS15 Protein (830-1069 aa), His-SUMO-tagged
Cat.No. : | TMPRSS15-2088M |
Product Overview : | Recombinant Mouse TMPRSS15 Protein (830-1069 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 830-1069 aa |
Description : | Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 43.0 kDa |
AA Sequence : | IVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFLH |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Tmprss15 transmembrane protease, serine 15 [ Mus musculus ] |
Official Symbol | TMPRSS15 |
Synonyms | TMPRSS15; enteropeptidase; enterokinase; serine protease 7; Prss7; A130097D21Rik; |
Gene ID | 19146 |
mRNA Refseq | NM_008941 |
Protein Refseq | NP_032967 |
UniProt ID | P97435 |
◆ Recombinant Proteins | ||
TMPRSS15-1456B | Recombinant Bovine TMPRSS15 protein | +Inquiry |
Tmprss15-2133M | Recombinant Mouse Tmprss15 Protein, His-tagged | +Inquiry |
TMPRSS15-157T | Active Recombinant Pig TMPRSS15 Protein | +Inquiry |
TMPRSS15-158T | Active Recombinant Bovine TMPRSS15 Protein (200 aa), His-tagged | +Inquiry |
Tmprss15-5921M | Recombinant Mouse Tmprss15 protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
TMPRSS15-001H | Recombinant Human TMPRSS15 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPRSS15-2800HCL | Recombinant Human PRSS7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMPRSS15 Products
Required fields are marked with *
My Review for All TMPRSS15 Products
Required fields are marked with *