Recombinant Mouse TMPRSS15 Protein (830-1069 aa), His-SUMO-tagged

Cat.No. : TMPRSS15-2088M
Product Overview : Recombinant Mouse TMPRSS15 Protein (830-1069 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 830-1069 aa
Description : Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 43.0 kDa
AA Sequence : IVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFLH
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Tmprss15 transmembrane protease, serine 15 [ Mus musculus ]
Official Symbol TMPRSS15
Synonyms TMPRSS15; enteropeptidase; enterokinase; serine protease 7; Prss7; A130097D21Rik;
Gene ID 19146
mRNA Refseq NM_008941
Protein Refseq NP_032967
UniProt ID P97435

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMPRSS15 Products

Required fields are marked with *

My Review for All TMPRSS15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon