Recombinant Mouse Tmsb10 protein, His-SUMO-tagged
Cat.No. : | Tmsb10-4600M |
Product Overview : | Recombinant Mouse Tmsb10 protein(Q6ZWY8)(2-44aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-44aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.8 kDa |
AA Sequence : | ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Tmsb10 thymosin, beta 10 [ Mus musculus ] |
Official Symbol | Tmsb10 |
Synonyms | TMSB10; thymosin, beta 10; thymosin beta-10; Tb10; Ptmb10; |
Gene ID | 19240 |
mRNA Refseq | NM_001039392 |
Protein Refseq | NP_001034481 |
◆ Recombinant Proteins | ||
TMSB10-1185H | Recombinant Human TMSB10 protein, GST-tagged | +Inquiry |
TMSB10-6188R | Recombinant Rat TMSB10 Protein | +Inquiry |
TMSB10-5845R | Recombinant Rat TMSB10 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMSB10-3451H | Recombinant Human TMSB10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Tmsb10-6529M | Recombinant Mouse Tmsb10 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMSB10-906HCL | Recombinant Human TMSB10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tmsb10 Products
Required fields are marked with *
My Review for All Tmsb10 Products
Required fields are marked with *