Recombinant Mouse Tmsb10 protein, His-SUMO-tagged

• Cat.No.: Tmsb10-4600M
• Product Overview: Recombinant Mouse Tmsb10 protein(Q6ZWY8)(2-44aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Mouse
• Tag: His-SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 17.8 kDa
• Protein length: 2-44aa
• AA Sequence: ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Tmsb10 thymosin, beta 10 [ Mus musculus ]
• Official Symbol: Tmsb10
• Synonyms: TMSB10; thymosin, beta 10; thymosin beta-10; Tb10; Ptmb10
• Gene ID: 19240
• mRNA Refseq: NM_001039392
• Protein Refseq: NP_001034481