Recombinant Mouse TSC22D4 Protein (1-387 aa), His-tagged
| Cat.No. : | TSC22D4-2121M |
| Product Overview : | Recombinant Mouse TSC22D4 Protein (1-387 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-387 aa |
| Description : | Transcriptional repressor. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 42.0 kDa |
| AA Sequence : | MSGGKKKSSFQITSVTTDYEGPGSPGASDSPVPPALAGPPPRLPNGDPNPDPGGRGTPRNGSPPPGAPASRFRVVKLPQGLGEPYRRGRWTCVDVYERDLEPPSFGRLLEGIRGASGGTGGRSLDSRLELASLGISTPIPQPGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLAGPGKAKVETPPLSASPPQQRPPGPGTGDSAQTLPSLRVEVESGGSAAATPPLSRRRDGAVRLRMELVAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRDLAERNAALEQENGLLRALASPEQLAQLPSSGLPRLGPSAPNGPSI |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Tsc22d4 TSC22 domain family, member 4 [ Mus musculus ] |
| Official Symbol | TSC22D4 |
| Synonyms | TSC22D4; Tilz2; AI415410; Thg-1pit; 0610009M14Rik; 1700023B23Rik; |
| Gene ID | 78829 |
| mRNA Refseq | NM_023910 |
| Protein Refseq | NP_076399 |
| UniProt ID | Q9EQN3 |
| ◆ Recombinant Proteins | ||
| TSC22D4-2121M | Recombinant Mouse TSC22D4 Protein (1-387 aa), His-tagged | +Inquiry |
| TSC22D4-17478M | Recombinant Mouse TSC22D4 Protein | +Inquiry |
| TSC22D4-9667M | Recombinant Mouse TSC22D4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TSC22D4-6312R | Recombinant Rat TSC22D4 Protein | +Inquiry |
| TSC22D4-5969R | Recombinant Rat TSC22D4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TSC22D4-1842HCL | Recombinant Human TSC22D4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSC22D4 Products
Required fields are marked with *
My Review for All TSC22D4 Products
Required fields are marked with *
