Recombinant Mouse TSC22D4 Protein (1-387 aa), His-tagged

Cat.No. : TSC22D4-2121M
Product Overview : Recombinant Mouse TSC22D4 Protein (1-387 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 1-387 aa
Description : Transcriptional repressor.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 42.0 kDa
AA Sequence : MSGGKKKSSFQITSVTTDYEGPGSPGASDSPVPPALAGPPPRLPNGDPNPDPGGRGTPRNGSPPPGAPASRFRVVKLPQGLGEPYRRGRWTCVDVYERDLEPPSFGRLLEGIRGASGGTGGRSLDSRLELASLGISTPIPQPGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLAGPGKAKVETPPLSASPPQQRPPGPGTGDSAQTLPSLRVEVESGGSAAATPPLSRRRDGAVRLRMELVAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRDLAERNAALEQENGLLRALASPEQLAQLPSSGLPRLGPSAPNGPSI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Tsc22d4 TSC22 domain family, member 4 [ Mus musculus ]
Official Symbol TSC22D4
Synonyms TSC22D4; Tilz2; AI415410; Thg-1pit; 0610009M14Rik; 1700023B23Rik;
Gene ID 78829
mRNA Refseq NM_023910
Protein Refseq NP_076399
UniProt ID Q9EQN3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TSC22D4 Products

Required fields are marked with *

My Review for All TSC22D4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon