Recombinant Mouse Tspo Full Length Transmembrane protein, His-tagged
Cat.No. : | Tspo-2404M |
Product Overview : | Recombinant Mouse Tspo protein(P50637)(1-169aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-169aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.7 kDa |
AA Sequence : | MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Tspo translocator protein [ Mus musculus ] |
Official Symbol | Tspo |
Synonyms | TSPO; translocator protein; PKBS; isoquinoline-binding protein; benzodiazepine receptor, peripheral; mitochondrial benzodiazepine receptor; peripheral-type benzodiazepine receptor; IBP; PBR; Bzrp; Tspo1; |
Gene ID | 12257 |
mRNA Refseq | NM_009775 |
Protein Refseq | NP_033905 |
◆ Recombinant Proteins | ||
TSPO-142HFL | Active Recombinant Full Length Human TSPO Protein, C-Flag-tagged | +Inquiry |
TSPO-6213H | Recombinant Human TSPO Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL35428SF | Recombinant Full Length Pig Translocator Protein(Tspo) Protein, His&Myc-Tagged | +Inquiry |
TSPO-9691M | Recombinant Mouse TSPO Protein, His (Fc)-Avi-tagged | +Inquiry |
TSPO-3462H | Recombinant Human TSPO, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPO-703HCL | Recombinant Human TSPO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tspo Products
Required fields are marked with *
My Review for All Tspo Products
Required fields are marked with *
0
Inquiry Basket