Recombinant Mouse Vsir Protein, His-tagged
Cat.No. : | Vsir-7415M |
Product Overview : | Recombinant mouse Vsir protein with a His tag was expressed in Sf9 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 33-191 |
Description : | Immunoregulatory receptor which inhibits the T-cell response. May promote differentiation of embryonic stem cells, by inhibiting BMP4 signaling. May stimulate MMP14-mediated MMP2 activation. |
Form : | Liquid |
Molecular Mass : | 18.8 kDa |
AA Sequence : | FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAALEHHHHHH |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Vsir V-set immunoregulatory receptor [ Mus musculus (house mouse) ] |
Official Symbol | Vsir |
Synonyms | Vsir; V-set immunoregulatory receptor; V; Die; PD-1; Dies1; PD-1H; VISTA; 4632428N05Rik; V-type immunoglobulin domain-containing suppressor of T-cell activation; V-set domain-containing immunoregulatory receptor; differentiation of ESCs 1; platelet receptor Gi24 |
Gene ID | 74048 |
mRNA Refseq | NM_001159572 |
Protein Refseq | NP_001153044 |
UniProt ID | Q9D659 |
◆ Recombinant Proteins | ||
Vsir-1012MAF555 | Recombinant Mouse Vsir Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
VSIR-2346H | Recombinant Human VSIR Protein, His (Fc)-Avi-tagged | +Inquiry |
VSIR-303CAF555 | Recombinant Monkey VISTA Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Vsir-717M | Recombinant Mouse Vsir protein, His-tagged | +Inquiry |
B7H5-1155RAF488 | Recombinant Rat B7H5 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Vsir Products
Required fields are marked with *
My Review for All Vsir Products
Required fields are marked with *