Recombinant Mouse Vsir Protein, His-tagged
| Cat.No. : | Vsir-7415M |
| Product Overview : | Recombinant mouse Vsir protein with a His tag was expressed in Sf9 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 33-191 |
| Description : | Immunoregulatory receptor which inhibits the T-cell response. May promote differentiation of embryonic stem cells, by inhibiting BMP4 signaling. May stimulate MMP14-mediated MMP2 activation. |
| Form : | Liquid |
| Molecular Mass : | 18.8 kDa |
| AA Sequence : | FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAALEHHHHHH |
| Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
| Purity : | > 90 % by SDS-PAGE |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : | 1.0 mg/mL (determined by absorbance at 280nm) |
| Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
| Gene Name | Vsir V-set immunoregulatory receptor [ Mus musculus (house mouse) ] |
| Official Symbol | Vsir |
| Synonyms | Vsir; V-set immunoregulatory receptor; V; Die; PD-1; Dies1; PD-1H; VISTA; 4632428N05Rik; V-type immunoglobulin domain-containing suppressor of T-cell activation; V-set domain-containing immunoregulatory receptor; differentiation of ESCs 1; platelet receptor Gi24 |
| Gene ID | 74048 |
| mRNA Refseq | NM_001159572 |
| Protein Refseq | NP_001153044 |
| UniProt ID | Q9D659 |
| ◆ Recombinant Proteins | ||
| VSIR-4610H | Recombinant Human VSIR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| VSIR-838H | Recombinant Human VSIR Protein, His-Avi-tagged, Biotinylated | +Inquiry |
| VSIR-1519R | Recombinant Rhesus Monkey VSIR Protein, hIgG1-tagged | +Inquiry |
| VSIR-059H | Active Recombinant Human VSIR protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
| Vsir-1012MF | Recombinant Mouse Vsir Protein, His-tagged, FITC conjugated | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Vsir Products
Required fields are marked with *
My Review for All Vsir Products
Required fields are marked with *
