"WNT7B" Related Products

Expand
Expand

Recombinant Mouse WNT7B Protein (25-349 aa), His-SUMO-Myc-tagged

Cat.No. : WNT7B-2310M
Product Overview : Recombinant Mouse WNT7B Protein (25-349 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Stem Cells. Protein Description: Full Length of Mature Protein.
Description : Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters.
Source : E. coli
Species : Mouse
Tag : His-SUMO-Myc
Form : Tris-based buffer,50% glycerol
Molecular Mass : 56.3 kDa
Protein length : 25-349 aa
AA Sequence : ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGIDECQHQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name : Wnt7b wingless-related MMTV integration site 7B [ Mus musculus ]
Official Symbol : WNT7B
Synonyms : WNT7B; wingless-related MMTV integration site 7B; protein Wnt-7b; Wnt-7b;
Gene ID : 22422
mRNA Refseq : NM_001163633
Protein Refseq : NP_001157105
UniProt ID : P28047

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.