Recombinant Mouse WNT7B Protein (25-349 aa), His-SUMO-Myc-tagged
Cat.No. : | WNT7B-2310M |
Product Overview : | Recombinant Mouse WNT7B Protein (25-349 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Stem Cells. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 25-349 aa |
Description : | Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 56.3 kDa |
AA Sequence : | ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGIDECQHQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Wnt7b wingless-related MMTV integration site 7B [ Mus musculus ] |
Official Symbol | WNT7B |
Synonyms | WNT7B; wingless-related MMTV integration site 7B; protein Wnt-7b; Wnt-7b; |
Gene ID | 22422 |
mRNA Refseq | NM_001163633 |
Protein Refseq | NP_001157105 |
UniProt ID | P28047 |
◆ Recombinant Proteins | ||
WNT7B-588H | Recombinant Human WNT7B Protein, His&SUMO-tagged | +Inquiry |
WNT7B-2291H | Recombinant Human WNT7B Protein (25-349 aa), His-SUMO-Myc-tagged | +Inquiry |
WNT7B-3291C | Recombinant Chicken WNT7B | +Inquiry |
WNT7B-2786H | Recombinant Human WNT7B Protein (25-349 aa), His-Myc-tagged | +Inquiry |
WNT7B-15H | Recombinant Human WNT7B protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT7B-288HCL | Recombinant Human WNT7B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT7B Products
Required fields are marked with *
My Review for All WNT7B Products
Required fields are marked with *