Recombinant Mouse Zp3 protein, His-tagged
Cat.No. : | Zp3-3545M |
Product Overview : | Recombinant Mouse Zp3 protein(P10761)(23-351aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-351aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.2 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QTLWLLPGGTPTPVGSSSPVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPRQGNVSSHPIQPTWVPFRATVSSEEKLAFSLRLMEENWNTEKSAPTFHLGEVAHLQAEVQTGSHLPLQLFVDHCVATPSPLPDPNSSPYHFIVDFHGCLVDGLSESFSAFQVPRPRPETLQFTVDVFHFANSSRNTLYITCHLKVAPANQIPDKLNKACSFNKTSQSWLPVEGDADICDCCSHGNCSNSSSSQFQIHGPRQWSKLVSRN |
Gene Name | Zp3 zona pellucida glycoprotein 3 [ Mus musculus ] |
Official Symbol | Zp3 |
Synonyms | ZP3; zona pellucida glycoprotein 3; zona pellucida sperm-binding protein 3; sperm receptor; zona pellucida protein C; zona pellucida glycoprotein ZP3; Zp-3; |
Gene ID | 22788 |
mRNA Refseq | NM_011776 |
Protein Refseq | NP_035906 |
◆ Recombinant Proteins | ||
ZP3-6716R | Recombinant Rat ZP3 Protein | +Inquiry |
ZP3-3784H | Recombinant Human ZP3 protein, His-SUMO-tagged | +Inquiry |
ZP3-5959C | Recombinant Chicken ZP3 | +Inquiry |
ZP3-6585H | Recombinant Human ZP3 Protein (Gln23-Val387), C-His tagged | +Inquiry |
RFL30192GF | Recombinant Full Length Chicken Zona Pellucida Sperm-Binding Protein 3(Zp3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZP3-2099HCL | Recombinant Human ZP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Zp3 Products
Required fields are marked with *
My Review for All Zp3 Products
Required fields are marked with *