Recombinant Mycobacterium Tuberculosis groEL2 protein, His-tagged
| Cat.No. : | groEL2-33M |
| Product Overview : | Recombinant Mycobacterium Tuberculosis groEL2 fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mycobacterium Tuberculosis |
| Source : | E.coli |
| Tag : | His |
| Description : | Heat shock proteins induce pro-inflammatory cytokines. Mycobacterial HSPs participate in cytokine expression resulting from infection by M. tuberculosis. Furthermore, HSPs stabilize cellular proteins in response to various sources of stress or injury. HSP65 is one of the most essential defending immunogens against the tuberculosis infection. HSP65 is presented to human CD41 T cells in association with multiple HLA-DR molecules. The M. tuberculosis HSP65 signals through TLR4. |
| Form : | The HSP65 protein was lyophilized from a concentrated (1mg/ml) solution containing 10mM Na-phosphate pH-7.4, 130mM NaCl and 2.5mM KCl. |
| Molecular Mass : | 57.4 kDa |
| AA Sequence : | HHHHHHGSAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEIELEDPYEKI GAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPLGLKRGIEAVEKVTETLLKGAKEVETKEQI AATAAISAGDQSIGDLIAEAMDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPY ILLVSSKVSTVKDLLPLLEKVIGAGKPLLIIEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLQDMAIL TGGQVISEEVGLTLENADLSLLGKARKVVVTKDETTIVEGAGDTDAIAGRVAQIRQEIENSDSDYDREKLQERL AKLAGGVAVKAGAATEVELKERKHRIEDAVRNAKAAVEEGIVAGGGVTLLQAAPTLDELKLEGDEATGANIVKVA LEAPLKQIAFNSGLEPGVVAEKVRNLPAGHGLNAQTGVYEDLLAAGVADPVKVTRSALQNASIAGLFLTTEAVV ADKPEKEKASVPGGGDMGGMDF |
| Purity : | Greater than 95.0% as determined by SDS-PAGE. |
| Stability : | Lyophilized HSP65 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution HSP65 should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Storage : | Storage at -70 centigrade |
| Reconstitution : | It is recommended to reconstitute the lyophilized HSP-65 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Gene Name | groEL2 molecular chaperone GroEL [ Mycobacterium tuberculosis H37Rv ] |
| Official Symbol | groEL2 |
| Synonyms | groEL-2; groL2; hsp60; hsp65; molecular chaperone GroEL |
| Gene ID | 886354 |
| mRNA Refseq | |
| Protein Refseq | NP_214954 |
| MIM | |
| UniProt ID | P9WPE7 |
| Pathway | RNA degradation, organism-specific biosystem; RNA degradation, conserved biosystem; Tuberculosis, organism-specific biosystem |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All groEL2 Products
Required fields are marked with *
My Review for All groEL2 Products
Required fields are marked with *
