Recombinant Mycobacterium Tuberculosis groEL2 protein, His-tagged

Cat.No. : groEL2-33M
Product Overview : Recombinant Mycobacterium Tuberculosis groEL2 fused with His tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mycobacterium Tuberculosis
Source : E.coli
Tag : His
Description : Heat shock proteins induce pro-inflammatory cytokines. Mycobacterial HSPs participate in cytokine expression resulting from infection by M. tuberculosis. Furthermore, HSPs stabilize cellular proteins in response to various sources of stress or injury. HSP65 is one of the most essential defending immunogens against the tuberculosis infection. HSP65 is presented to human CD41 T cells in association with multiple HLA-DR molecules. The M. tuberculosis HSP65 signals through TLR4.
Form : The HSP65 protein was lyophilized from a concentrated (1mg/ml) solution containing 10mM Na-phosphate pH-7.4, 130mM NaCl and 2.5mM KCl.
Molecular Mass : 57.4 kDa
AA Sequence : HHHHHHGSAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEIELEDPYEKI GAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPLGLKRGIEAVEKVTETLLKGAKEVETKEQI AATAAISAGDQSIGDLIAEAMDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPY ILLVSSKVSTVKDLLPLLEKVIGAGKPLLIIEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLQDMAIL TGGQVISEEVGLTLENADLSLLGKARKVVVTKDETTIVEGAGDTDAIAGRVAQIRQEIENSDSDYDREKLQERL AKLAGGVAVKAGAATEVELKERKHRIEDAVRNAKAAVEEGIVAGGGVTLLQAAPTLDELKLEGDEATGANIVKVA LEAPLKQIAFNSGLEPGVVAEKVRNLPAGHGLNAQTGVYEDLLAAGVADPVKVTRSALQNASIAGLFLTTEAVV ADKPEKEKASVPGGGDMGGMDF
Purity : Greater than 95.0% as determined by SDS-PAGE.
Stability : Lyophilized HSP65 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution HSP65 should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Storage : Storage at -70 centigrade
Reconstitution : It is recommended to reconstitute the lyophilized HSP-65 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Gene Name groEL2 molecular chaperone GroEL [ Mycobacterium tuberculosis H37Rv ]
Official Symbol groEL2
Synonyms groEL-2; groL2; hsp60; hsp65; molecular chaperone GroEL
Gene ID 886354
mRNA Refseq
Protein Refseq NP_214954
MIM
UniProt ID P9WPE7
Pathway RNA degradation, organism-specific biosystem; RNA degradation, conserved biosystem; Tuberculosis, organism-specific biosystem

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All groEL2 Products

Required fields are marked with *

My Review for All groEL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon