Recombinant Mycobacterium tuberculosis (strain CDC 1551/Oshkosh) Diacylglycerol acyltransferase/mycolyltransferase Ag85A(fbpA) protein, His-tagged

Cat.No. : fbpA-2023M
Product Overview : Recombinant Mycobacterium tuberculosis (strain CDC 1551/Oshkosh) Diacylglycerol acyltransferase/mycolyltransferase Ag85A(fbpA) partial protein (53-331aa) was fused to His-tag at N-terminus and expressed in E.coli.
Availability December 25, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Species : Mycobacterium Tuberculosis
Source : E.coli
Tag : His
Protein Length : 279
Description : The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM. FbpA mediates triacylglycerol (TAG) formation with long-chain acyl-CoA as the acyl donor and 1,2-dipalmitoyl-sn-glycerol (1,2-dipalmitin) as the acyl acceptor (By similarity).
Form : Liquid or Lyophilized powder. If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol; If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 34.1 kDa
AA Sequence : YLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNT
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20 centigrade upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Expiry : Generally, the shelf life of liquid form is 6 months at -20/-80 centigrade. The shelf life of lyophilized form is 12 months at -20/-80 centigrade.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Publications :
An aptamer for recognizing the transmembrane protein PDL-1 (programmed death-ligand 1), and its application to fluorometric single cell detection of human ovarian carcinoma cells (2017)
Design, isolation and evaluation of the binding efficiency of a DNA aptamer against interleukin 2 receptor alpha, in vitro. (2017)
Selection of DNA aptamers against Mycobacterium tuberculosis Ag85A, and its application in a graphene oxide-based fluorometric assay (2018)
Gene Name fbpA
Official Symbol fbpA
Synonyms Acyl-CoA; Ag85A; Fbps A; 85A; mpt44
Gene ID 886132
Protein Refseq NP_218321.1
UniProt ID P9WQP2

Selection of DNA aptamers against Mycobacterium tuberculosis Ag85A, and its application in a graphene oxide-based fluorometric assay.

Journal: Mikrochimica acta    PubMed ID: 29594592    Data: 2019/2/4

Authors: Najmeh Ansari, Kiarash Ghazvini, Seyed Mohammad Taghdisi

Article Snippet: Recombinant FbpA protein of M. tuberculosis (His Tag#2023 M) was provided by Creative BioMart (USA) (http://www.creativebiomart.net). . Recombinant IL2Rα/ CD25 protein (His Tag-#10,165-H08H), PD1 (#10377- H08H-50) and PDL1 (#10084-H08H-200) were purchased from Sino biological (China) (www.sinobiological.com).Recombinant IL2Rα/ CD25 protein (His Tag-#10,165-H08H), PD1 (#10377- H08H-50) and PDL1 (#10084-H08H-200) were purchased from Sino biological (China) (www.sinobiological.com).

Design, isolation and evaluation of the binding efficiency of a DNA aptamer against interleukin 2 receptor alpha, in vitro.

Journal: International immunopharmacology    PubMed ID: 29055191    Data: 2018/7/23

Authors: Mahin Shahdordizadeh, Seyed Mohammad Taghdisi, Khalil Abnous

Article Snippet:Recombinant IL2Rα/CD25 protein (His Tag-#10165-H08H), PD1 (#10377-H08H-50) and PDL1 (#10084-H08H-200) were purchased from Sino Biological (China).Recombinant IL2Rα/CD25 protein (His Tag-#10165-H08H), PD1 (#10377-H08H-50) and PDL1 (#10084-H08H-200) were purchased from Sino Biological (China).. Recombinant FbpA protein of Mycobacterium Tuberculosis (#2023M) was provided by Creative BioMart (USA). . Magnetic beads (#36111) and Ni-NTA HisSorb Stripes (#35023) were ordered from Qiagen Company (Germany).Magnetic beads (#36111) and Ni-NTA HisSorb Stripes (#35023) were ordered from Qiagen Company (Germany).

An aptamer for recognizing the transmembrane protein PDL-1 (programmed death-ligand 1), and its application to fluorometric single cell detection of human ovarian carcinoma cells

Journal: Microchimica Acta    Data: 2017/8/2

Authors: Rezvan Yazdian-Robati, Mohammad Ramezani, Seyed Mohammad Taghdisi

Article Snippet:Human PD-L1/CD274-His Tag (Cat No = 10,084-H08H), PD1-His Tag (Cat No = 10,377-H08H) and recombinant IL2Ra/CD25 protein-His Tag (10165-H08H) were purchased from Sinobiological (China) (www.sinobiological.com).Human PD-L1/CD274-His Tag (Cat No = 10,084-H08H), PD1-His Tag (Cat No = 10,377-H08H) and recombinant IL2Ra/CD25 protein-His Tag (10165-H08H) were purchased from Sinobiological (China) (www.sinobiological.com).. Recombinant Mycobacterium tuberculosis FbpA-His Tag (#2023 M) was provided from Creative BioMart (USA) (www.creativebiomart.net). . PE-labeled anti-human CD274 (B7-H1, PD-L1) antibody (#329705) was purchased from Biolegend (USA) (https://www.biolegend.com).PE-labeled anti-human CD274 (B7-H1, PD-L1) antibody (#329705) was purchased from Biolegend (USA) (https://www.biolegend.com).

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All fbpA Products

Required fields are marked with *

My Review for All fbpA Products

Required fields are marked with *

0
cart-icon
0
compare icon