Recombinant Neosartorya Fumigata CRF1 Protein (42-233 aa), His-Myc-tagged
| Cat.No. : | CRF1-2698N |
| Product Overview : | Recombinant Neosartorya Fumigata (strain ATCC MYA-4609/Af293/CBS 101355/FGSC A1100) (Aspergillus fumigatus) CRF1 Protein (42-233 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Metabolism. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Neosartorya Fumigata |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 42-233 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 28.1 kDa |
| AA Sequence : | TYTADFTSASALDQWEVTAGKVPVGPQGAEFTVAKQGDAPTIDTDFYFFFGKAEVVMKAAPGTGVVSSIVLESDDLDEVDWEVLGGDTTQVQTNYFGKGDTTTYDRGTYVPVATPQETFHTYTIDWTKDAVTWSIDGAVVRTLTYNDAKGGTRFPQTPMRLRLGSWAGGDPSNPKGTIEWAGGLTDYSAGPY |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Synonyms | crf1; |
| UniProt ID | Q8J0P4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRF1 Products
Required fields are marked with *
My Review for All CRF1 Products
Required fields are marked with *




