Recombinant Newcastle Disease Virus HN Protein (115-473 aa), His-Myc-tagged

Cat.No. : HN-2230N
Product Overview : Recombinant Newcastle Disease Virus (strain Her/33) (NDV) HN Protein (115-473 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : NDV
Source : Yeast
Tag : His&Myc
Protein Length : 115-473 aa
Description : Attaches the virus to sialic acid-containing cell receptors and thereby initiating infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusionNeuraminidase activity ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 42.7 kDa
AA Sequence : NGAANNSGCGAPVHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDISATHYCYTHNVILSGCRDHSHSHQYLALGVLRTSATGRVFFSTLRSINLDDNQNRKSCSVSATPLGCDMLCSKITETEEEDYSSVTPTSMVHGRLGFDGQYHEKDLDVITLFKDWVANYPGVGGGSFIDNRVWFPVYGGLKPNSPSDTVQEGRYVIYKRYNDTCPDEQDYQIRMAKSSYKPGRFGGKRVQQAILSIKVSTSLGEDPVLTIPPNTVTLMGAEGRVLTVGTSHFLYQRGSSYFSPALLYPMTVNNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCVTGVYTDP
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name HN hemagglutinin-neuraminidase [ Avian avulavirus 1 ]
Official Symbol HN
Synonyms HN;
Gene ID 37627205
UniProt ID P35741

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HN Products

Required fields are marked with *

My Review for All HN Products

Required fields are marked with *

0
cart-icon