Recombinant Newcastle Disease Virus HN Protein (115-473 aa), His-Myc-tagged
Cat.No. : | HN-2230N |
Product Overview : | Recombinant Newcastle Disease Virus (strain Her/33) (NDV) HN Protein (115-473 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | NDV |
Source : | Yeast |
Tag : | His&Myc |
Protein Length : | 115-473 aa |
Description : | Attaches the virus to sialic acid-containing cell receptors and thereby initiating infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusionNeuraminidase activity ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 42.7 kDa |
AA Sequence : | NGAANNSGCGAPVHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDISATHYCYTHNVILSGCRDHSHSHQYLALGVLRTSATGRVFFSTLRSINLDDNQNRKSCSVSATPLGCDMLCSKITETEEEDYSSVTPTSMVHGRLGFDGQYHEKDLDVITLFKDWVANYPGVGGGSFIDNRVWFPVYGGLKPNSPSDTVQEGRYVIYKRYNDTCPDEQDYQIRMAKSSYKPGRFGGKRVQQAILSIKVSTSLGEDPVLTIPPNTVTLMGAEGRVLTVGTSHFLYQRGSSYFSPALLYPMTVNNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCVTGVYTDP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | HN hemagglutinin-neuraminidase [ Avian avulavirus 1 ] |
Official Symbol | HN |
Synonyms | HN; |
Gene ID | 37627205 |
UniProt ID | P35741 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *