Recombinant Norovirus ORF2 Protein, His-tagged

• Cat.No.: ORF2-30N
• Product Overview: Recombinant Norovirus ORF2 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Norovirus
• Source: E.coli
• Tag: His
• Description: VP1
• Form: Supplied as a 0.2 μm filtered solution in 50mM Tris, 300mM NaCl, 2M urea, pH 8.0.
• Molecular Mass: 36.3 kDa
• AA Sequence: MHHHHHHSKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTTQLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFGIISQRDRHNSPGHNEPANRGHDTVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFTPVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGSPAIDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAPVVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/ml

Gene Information

• Gene Name: ORF2 VP1 [ Norovirus GV ]
• Official Symbol: ORF2
• Gene ID: 4246736
• Protein Refseq: YP_720002
• UniProt ID: Q83884