Recombinant Norovirus ORF2 Protein, His-tagged
| Cat.No. : | ORF2-30N |
| Product Overview : | Recombinant Norovirus ORF2 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Norovirus |
| Source : | E.coli |
| Tag : | His |
| Description : | VP1 |
| Form : | Supplied as a 0.2 μm filtered solution in 50mM Tris, 300mM NaCl, 2M urea, pH 8.0. |
| Molecular Mass : | 36.3 kDa |
| AA Sequence : | MHHHHHHSKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTTQLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFGIISQRDRHNSPGHNEPANRGHDTVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFTPVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGSPAIDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAPVVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1 mg/ml |
| Gene Name | ORF2 VP1 [ Norovirus GV ] |
| Official Symbol | ORF2 |
| Gene ID | 4246736 |
| Protein Refseq | YP_720002 |
| UniProt ID | Q83884 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ORF2 Products
Required fields are marked with *
My Review for All ORF2 Products
Required fields are marked with *



