Recombinant Pig AVPR2 Protein (292-370 aa), His-SUMO-tagged
Cat.No. : | AVPR2-2048P |
Product Overview : | Recombinant Pig AVPR2 Protein (292-370 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 292-370 aa |
Description : | Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase (PubMed:8393786). Involved in renal water reabsorption (By similarity). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.7 kDa |
AA Sequence : | WSVWDPKAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATASSFSARDTSS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | AVPR2 arginine vasopressin receptor 2 [ Sus scrofa ] |
Official Symbol | AVPR2 |
Synonyms | AVPR2; 2R; AVPR V2; antidiuretic hormone receptor; |
Gene ID | 397462 |
mRNA Refseq | NM_214232 |
Protein Refseq | NP_999397 |
UniProt ID | P32307 |
◆ Recombinant Proteins | ||
AVPR2-908R | Recombinant Rat AVPR2 Protein | +Inquiry |
AVPR2-915M | Recombinant Mouse AVPR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AVPR2-3126C | Recombinant Chicken AVPR2 | +Inquiry |
AVPR2-1052HFL | Recombinant Human AVPR2 protein, His&Flag-tagged | +Inquiry |
RFL27506BF | Recombinant Full Length Bovine Vasopressin V2 Receptor(Avpr2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AVPR2-8557HCL | Recombinant Human AVPR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AVPR2 Products
Required fields are marked with *
My Review for All AVPR2 Products
Required fields are marked with *