Recombinant Pig AVPR2 Protein (292-370 aa), His-SUMO-tagged

• Cat.No.: AVPR2-2048P
• Product Overview: Recombinant Pig AVPR2 Protein (292-370 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Pig
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 292-370 aa
• Description: Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase (PubMed:8393786). Involved in renal water reabsorption (By similarity).
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 24.7 kDa
• AA Sequence: WSVWDPKAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATASSFSARDTSS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: AVPR2 arginine vasopressin receptor 2 [ Sus scrofa ]
• Official Symbol: AVPR2
• Synonyms: AVPR2; 2R; AVPR V2; antidiuretic hormone receptor
• Gene ID: 397462
• mRNA Refseq: NM_214232
• Protein Refseq: NP_999397
• UniProt ID: P32307