Recombinant Pig BCMA Protein, His-tagged
Cat.No. : | TNFRSF17-03P |
Product Overview : | Recombinant Pig BCMA Protein(XP_020943721.1), fused to His tag, was expressed in HEK293. |
Availability | October 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | HEK293 |
Tag : | His |
Form : | Supplied as a 0.2 μm filtered solution in PBS (pH 7.4) |
Molecular Mass : | The Predicted Molecular Mass is about 6 kDa. |
AA Sequence : | MAQQCYQNEYFDRLLIACKPCRLRCSNTPPVTCQHYCNTMKGTNVHHHHHH |
Endotoxin : | <1EU per ug (determined by the LAL method) |
Purity : | >90% as determined by SDS-PAGE |
Storage : | Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.0 mg/ml |
Gene Name | TNFRSF17 TNF receptor superfamily member 17 [ Sus scrofa (pig) ] |
Official Symbol | TNFRSF17 |
Gene ID | 100517087 |
mRNA Refseq | XM_021088062.1 |
Protein Refseq | XP_020943721.1 |
◆ Recombinant Proteins | ||
Tnfrsf17-882M | Active Recombinant Mouse Tnfrsf17 protein, hFc&Avi-tagged, Biotinylated | +Inquiry |
Tnfrsf17-2266MA | Recombinant Mouse Tnfrsf17 protein, Fc-His-tagged, APC labeled | +Inquiry |
TNFRSF17-3928H | Active Recombinant Human TNFRSF17 protein, His-tagged, Site-specific APC-Labeled | +Inquiry |
TNFRSF17-237HP | Recombinant Human TNFRSF17 protein, Fc-tagged, R-PE labeled | +Inquiry |
TNFRSF17-26737TH | Recombinant Human TNFRSF17 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF17-2593MCL | Recombinant Mouse TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-2489HCL | Recombinant Human TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-1489RCL | Recombinant Rat TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-1253CCL | Recombinant Cynomolgus TNFRSF17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF17 Products
Required fields are marked with *
My Review for All TNFRSF17 Products
Required fields are marked with *