Recombinant Pig BCMA Protein, His-tagged
| Cat.No. : | TNFRSF17-03P |
| Product Overview : | Recombinant Pig BCMA Protein(XP_020943721.1), fused to His tag, was expressed in HEK293. |
| Availability | January 17, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pig |
| Source : | HEK293 |
| Tag : | His |
| Form : | Supplied as a 0.2 μm filtered solution in PBS (pH 7.4) |
| Molecular Mass : | The Predicted Molecular Mass is about 6 kDa. |
| AA Sequence : | MAQQCYQNEYFDRLLIACKPCRLRCSNTPPVTCQHYCNTMKGTNVHHHHHH |
| Endotoxin : | <1EU per ug (determined by the LAL method) |
| Purity : | >90% as determined by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.0 mg/ml |
| Gene Name | TNFRSF17 TNF receptor superfamily member 17 [ Sus scrofa (pig) ] |
| Official Symbol | TNFRSF17 |
| Gene ID | 100517087 |
| mRNA Refseq | XM_021088062.1 |
| Protein Refseq | XP_020943721.1 |
| ◆ Recombinant Proteins | ||
| Tnfrsf17-259M | Recombinant Mouse Tnfrsf17 Protein, Met1-Thr49, C-His-Avi tagged, Biotinylated | +Inquiry |
| TNFRSF17-2918H | Recombinant Human TNFRSF17 protein, His-tagged, Alexa Fluor 488-Labeled | +Inquiry |
| Tnfrsf17-7442RAF488 | Recombinant Rat Tnfrsf17 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| TNFRSF17-8829CAF647 | Active Recombinant Monkey TNFRSF17 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| Tnfrsf17-803M | Recombinant Mouse Tnfrsf17 protein, His-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF17-1253CCL | Recombinant Cynomolgus TNFRSF17 cell lysate | +Inquiry |
| TNFRSF17-2489HCL | Recombinant Human TNFRSF17 cell lysate | +Inquiry |
| TNFRSF17-1489RCL | Recombinant Rat TNFRSF17 cell lysate | +Inquiry |
| TNFRSF17-2593MCL | Recombinant Mouse TNFRSF17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF17 Products
Required fields are marked with *
My Review for All TNFRSF17 Products
Required fields are marked with *
