Recombinant Pig DEFB1 protein, GST-tagged
Cat.No. : | DEFB1-6766P |
Product Overview : | Recombinant Pig DEFB1 protein(O62697)(24-64aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | GST |
Protein Length : | 24-64aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | NIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK |
Gene Name | DEFB1 defensin, beta 1 [ Sus scrofa ] |
Official Symbol | DEFB1 |
Synonyms | DEFB1; defensin, beta 1; beta-defensin 1; BD-1; prepro-beta-defensin 1; PBD-1; |
Gene ID | 396819 |
mRNA Refseq | NM_213838 |
Protein Refseq | NP_999003 |
◆ Recombinant Proteins | ||
DEFB1-1487R | Recombinant Rat DEFB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEFB1-1946H | Recombinant Human DEFB1 Protein (Gly22-Lys68), N-GST tagged | +Inquiry |
Defb1-6877M | Recombinant Mouse Defb1 protein, His & S-tagged | +Inquiry |
DEFB1-2430HF | Recombinant Full Length Human DEFB1 Protein, GST-tagged | +Inquiry |
DEFB1-17H | Active Recombinant Human DEFB1 protein(1-47aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFB1-6989HCL | Recombinant Human DEFB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFB1 Products
Required fields are marked with *
My Review for All DEFB1 Products
Required fields are marked with *