Recombinant Pig EPO protein, His-B2M-tagged
| Cat.No. : | EPO-2862P |
| Product Overview : | Recombinant Pig EPO protein(P49157)(27-194aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pig |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 27-194aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 32.6 kDa |
| AA Sequence : | APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | EPO erythropoietin [ Sus scrofa ] |
| Official Symbol | EPO |
| Synonyms | EPO; erythropoietin; |
| Gene ID | 397249 |
| mRNA Refseq | NM_214134 |
| Protein Refseq | NP_999299 |
| ◆ Recombinant Proteins | ||
| Epo-606R | Recombinant Rat Epo protein, His & T7-tagged | +Inquiry |
| EPO-2524H | Recombinant Human EPO Protein (Ala28-Arg193), N-His tagged | +Inquiry |
| EPO-2860H | Recombinant Horse EPO protein, His-SUMO-tagged | +Inquiry |
| epo-2859Z | Recombinant Zebrafish epo protein, His-tagged | +Inquiry |
| EPO-104S | Recombinant Swine EPO | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EPO-592RCL | Recombinant Rat EPO cell lysate | +Inquiry |
| EPO-1450MCL | Recombinant Mouse EPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPO Products
Required fields are marked with *
My Review for All EPO Products
Required fields are marked with *
