Recombinant Pig FGF2 protein, His-tagged
Cat.No. : | FGF2-4679P |
Product Overview : | Recombinant Pig FGF2 protein(A0A287BGK8)(1-165 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-165 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 18.2 kDa |
AASequence : | GSRSGRPRGRPQKTGASRGRRAGREEGRGRGGWWAFGGGDVEDVTPRGSAGARPADSEPAVASRSRALQFGEAALPRVAAAEKPSPNPQLQGRRRAKRPNSTRLGARGRGRVPRGGRLGGRGRGRAPERVGGRGRGSAAAAAAAPRAAPGARGPRQSPGGAMAAG |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | FGF2 fibroblast growth factor 2 (basic) [ Sus scrofa ] |
Official Symbol | FGF2 |
Synonyms | FGF2; fibroblast growth factor 2 (basic); |
Gene ID | 397643 |
◆ Recombinant Proteins | ||
FGF2-293H | Recombinant Human FGF2, StrepII-tagged | +Inquiry |
FGF2-1487H | Recombinant Human FGF2 Protein, His-tagged | +Inquiry |
FGF2-91H | Recombinant Human FGF2,His-tagged | +Inquiry |
FGF2-4387R | Recombinant Rabbit FGF2 Protein | +Inquiry |
FGF2-1488H | Recombinant Human FGF2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGF2-066D | Recombinant Duck FGF Basic Protein, Tag Free | +Inquiry |
FGF2-065C | Recombinant Chicken FGF Basic Protein, Tag Free | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *