Recombinant Pig TSPO Full Length Transmembrane protein (1-169 aa), His-SUMO-Myc-tagged
Cat.No. : | TSPO-2722P |
Product Overview : | Recombinant Pig TSPO Protein (1-169 aa) is produced by in vitro E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-169aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.6 kDa |
AA Sequence : | MAPPWLPAVGFTLVPSLGGFLSSRNVLGKGLHWYAGLQKPSWHPPHWTLAPIWGTLYSAMGYGSYMIWKELGGFSEEAVVPLGLYAGQLALNWAWPPLFFGARQMGWALVDLVLTGGVAAATAVAWYQVSPLAARLLYPYLAWLAFAATLNYCVWRDNQGRRGGRRPSE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TSPO translocator protein (18kDa) [ Sus scrofa ] |
Official Symbol | TSPO |
Synonyms | TSPO; translocator protein (18kDa); translocator protein; peripheral benzodiazepine receptor; peripheral-type benzodiazepine receptor; PBR; BZRP; |
Gene ID | 396592 |
mRNA Refseq | NM_213753 |
Protein Refseq | NP_998918 |
◆ Recombinant Proteins | ||
TSPO-17519M | Recombinant Mouse TSPO Protein | +Inquiry |
TSPO-3462H | Recombinant Human TSPO, His-tagged | +Inquiry |
RFL20879AF | Recombinant Full Length Arabidopsis Thaliana Translocator Protein Homolog(Tspo) Protein, His-Tagged | +Inquiry |
TSPO-4819R | Recombinant Rhesus Macaque TSPO Protein, His (Fc)-Avi-tagged | +Inquiry |
TSPO-5985R | Recombinant Rat TSPO Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPO-703HCL | Recombinant Human TSPO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSPO Products
Required fields are marked with *
My Review for All TSPO Products
Required fields are marked with *