Recombinant Pig TSPO Full Length Transmembrane protein (1-169 aa), His-SUMO-Myc-tagged

• Cat.No.: TSPO-2722P
• Product Overview: Recombinant Pig TSPO Protein (1-169 aa) is produced by in vitro E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal.

Specification

• Species: Pig
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-169aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 38.6 kDa
• AA Sequence: MAPPWLPAVGFTLVPSLGGFLSSRNVLGKGLHWYAGLQKPSWHPPHWTLAPIWGTLYSAMGYGSYMIWKELGGFSEEAVVPLGLYAGQLALNWAWPPLFFGARQMGWALVDLVLTGGVAAATAVAWYQVSPLAARLLYPYLAWLAFAATLNYCVWRDNQGRRGGRRPSE
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TSPO translocator protein (18kDa) [ Sus scrofa ]
• Official Symbol: TSPO
• Synonyms: TSPO; translocator protein (18kDa); translocator protein; peripheral benzodiazepine receptor; peripheral-type benzodiazepine receptor; PBR; BZRP
• Gene ID: 396592
• mRNA Refseq: NM_213753
• Protein Refseq: NP_998918