Recombinant Pig TSPO Full Length Transmembrane protein (1-169 aa), His-SUMO-Myc-tagged

Cat.No. : TSPO-2722P
Product Overview : Recombinant Pig TSPO Protein (1-169 aa) is produced by in vitro E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pig
Source : E.coli
Tag : His&SUMO
Protein Length : 1-169aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 38.6 kDa
AA Sequence : MAPPWLPAVGFTLVPSLGGFLSSRNVLGKGLHWYAGLQKPSWHPPHWTLAPIWGTLYSAMGYGSYMIWKELGGFSEEAVVPLGLYAGQLALNWAWPPLFFGARQMGWALVDLVLTGGVAAATAVAWYQVSPLAARLLYPYLAWLAFAATLNYCVWRDNQGRRGGRRPSE
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name TSPO translocator protein (18kDa) [ Sus scrofa ]
Official Symbol TSPO
Synonyms TSPO; translocator protein (18kDa); translocator protein; peripheral benzodiazepine receptor; peripheral-type benzodiazepine receptor; PBR; BZRP;
Gene ID 396592
mRNA Refseq NM_213753
Protein Refseq NP_998918

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TSPO Products

Required fields are marked with *

My Review for All TSPO Products

Required fields are marked with *

0
cart-icon
0
compare icon