Recombinant Pongo Abelii TMEM168 Protein (527-637 aa), His-Myc-tagged
Cat.No. : | TMEM168-2625P |
Product Overview : | Recombinant Pongo Abelii (Sumatran orangutan) (Pongo pygmaeus abelii) TMEM168 Protein (527-637 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 527-637 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 19.8 kDa |
AA Sequence : | EWWREKNGSFCSRLIIVLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAK |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | TMEM168 transmembrane protein 168 [ Pongo abelii (Sumatran orangutan) ] |
Official Symbol | TMEM168 |
Synonyms | TMEM168; |
Gene ID | 100172041 |
mRNA Refseq | NM_001131682 |
Protein Refseq | NP_001125154 |
UniProt ID | Q5RD28 |
◆ Recombinant Proteins | ||
TMEM168-3280H | Recombinant Human TMEM168, His-tagged | +Inquiry |
TMEM168-6129R | Recombinant Rat TMEM168 Protein | +Inquiry |
TMEM168-2625P | Recombinant Pongo Abelii TMEM168 Protein (527-637 aa), His-Myc-tagged | +Inquiry |
TMEM168-9319M | Recombinant Mouse TMEM168 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM168-4596R | Recombinant Rhesus Macaque TMEM168 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM168 Products
Required fields are marked with *
My Review for All TMEM168 Products
Required fields are marked with *