Recombinant Porcine IFNA1 Protein, His-tagged

Cat.No. : IFNA1-01P
Product Overview : Recombinant porcine IFN-alpha 1, fused to His-tag at C-terminus, was expressed in HEK293 and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Porcine
Source : HEK293
Tag : His
Protein Length : 24-189
Description : Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Form : Liquid
Molecular Mass : 20.2kDa (176aa)
AA Sequence : CDLPQTHSLAHTRALRLLAQMRRISPFSCLDHRRDFGSPHEAFGGNQVQKAQAMALVHEMLQQTFQLFSTEGSAAAWNESLLHQFCTGLDQQLRDLEACVMQEAGLEGTPLLEEDSILAVRKYFHRLTLYLQEKSYSPCAWEIVRAEVMRSFSSSRNLQDRLRKKE
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90 % by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4) containing 10% glycerol
Gene Name IFNA1 interferon, alpha 1 [ Sus scrofa (pig) ]
Official Symbol IFNA1
Synonyms IFNA1; interferon, alpha 1; IFN1@; IFN-ALPHA-1; interferon alpha-1; IFN-alpha-6; interferon-alpha; interferon-alpha-6
Gene ID 397686
mRNA Refseq NM_214393
Protein Refseq NP_999558
UniProt ID Q6VAB8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNA1 Products

Required fields are marked with *

My Review for All IFNA1 Products

Required fields are marked with *

0
cart-icon
0
compare icon