Recombinant Porcine IFNA1 Protein, His-tagged

• Cat.No.: IFNA1-01P
• Product Overview: Recombinant porcine IFN-alpha 1, fused to His-tag at C-terminus, was expressed in HEK293 and purified by using conventional chromatography techniques.

Specification

• Species: Porcine
• Source: HEK293
• Tag: His
• Protein Length: 24-189
• Description: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
• Form: Liquid
• Molecular Mass: 20.2kDa (176aa)
• AA Sequence: CDLPQTHSLAHTRALRLLAQMRRISPFSCLDHRRDFGSPHEAFGGNQVQKAQAMALVHEMLQQTFQLFSTEGSAAAWNESLLHQFCTGLDQQLRDLEACVMQEAGLEGTPLLEEDSILAVRKYFHRLTLYLQEKSYSPCAWEIVRAEVMRSFSSSRNLQDRLRKKE
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90 % by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: IFNA1 interferon, alpha 1 [ Sus scrofa (pig) ]
• Official Symbol: IFNA1
• Synonyms: IFNA1; interferon, alpha 1; IFN1@; IFN-ALPHA-1; interferon alpha-1; IFN-alpha-6; interferon-alpha; interferon-alpha-6
• Gene ID: 397686
• mRNA Refseq: NM_214393
• Protein Refseq: NP_999558
• UniProt ID: Q6VAB8