Recombinant Porcine IL8 Protein

Cat.No. : IL8-191P
Product Overview : Recombinant Porcine IL8 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Porcine
Source : E.coli
Description : Interleukin 8 (IL-8 or CXCL8) is a member of the CXC cytokine family and is produced by macrophages, epithelial, smooth muscle, and endothelial cells. IL-8 binds the G protein-coupled serpentine receptors CXCR1 and CXCR2. IL-8 recruits innate immune cells, induces phagocytosis, and stimulates angiogenesis.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 9.1 kDa (78 aa)
AA Sequence : ARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 5 mM sodium phosphate, 20 mM sodium chloride, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name IL8 interleukin 8 [ Sus scrofa (pig) ]
Official Symbol IL8
Synonyms IL8; interleukin 8; interleukin-8; IL-8; C-X-C motif chemokine 8; alveolar macrophage chemotactic factor I; alveolar macrophage-derived chemotactic factor-I; CXCL8; AMCF-I;
Gene ID 396880
mRNA Refseq NM_213867
Protein Refseq NP_999032
UniProt ID P26894

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL8 Products

Required fields are marked with *

My Review for All IL8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon