Recombinant Protein Human XDH Protein, 1234-1332, N-GST tagged

Cat.No. : XDH-43H
Product Overview : Human XDH partial ORF ( NP_000370, 1234 a.a. - 1332 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1234-1332
Description : Xanthine dehydrogenase belongs to the group of molybdenum-containing hydroxylases involved in the oxidative metabolism of purines. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Xanthine dehydrogenase can be converted to xanthine oxidase by reversible sulfhydryl oxidation or by irreversible proteolytic modification. Defects in xanthine dehydrogenase cause xanthinuria, may contribute to adult respiratory stress syndrome, and may potentiate influenza infection through an oxygen metabolite-dependent mechanism.
Molecular Mass : 36.63 kDa
AA Sequence : GSIPIEFRVSLLRDCPNKKAIYASKAVGEPPLFLAASIFFAIKDAIRAARAQHTGNNVKELFRLDSPATPEKIRNACVDKFTTLCVTGVPENCKPWSVR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name XDH xanthine dehydrogenase [ Homo sapiens (human) ]
Official Symbol XDH
Synonyms XDH; xanthine dehydrogenase; xanthene dehydrogenase; xanthine dehydrogenase/oxidase; XO; XOR; xanthine oxidase; xanthine oxidoreductase
Gene ID 7498
mRNA Refseq NM_000379
Protein Refseq NP_000370
MIM 607633
UniProt ID P47989

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All XDH Products

Required fields are marked with *

My Review for All XDH Products

Required fields are marked with *

0
cart-icon
0
compare icon