Recombinant Protein Human XDH Protein, 1234-1332, N-GST tagged
Cat.No. : | XDH-43H |
Product Overview : | Human XDH partial ORF ( NP_000370, 1234 a.a. - 1332 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1234-1332 |
Description : | Xanthine dehydrogenase belongs to the group of molybdenum-containing hydroxylases involved in the oxidative metabolism of purines. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Xanthine dehydrogenase can be converted to xanthine oxidase by reversible sulfhydryl oxidation or by irreversible proteolytic modification. Defects in xanthine dehydrogenase cause xanthinuria, may contribute to adult respiratory stress syndrome, and may potentiate influenza infection through an oxygen metabolite-dependent mechanism. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | GSIPIEFRVSLLRDCPNKKAIYASKAVGEPPLFLAASIFFAIKDAIRAARAQHTGNNVKELFRLDSPATPEKIRNACVDKFTTLCVTGVPENCKPWSVR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | XDH xanthine dehydrogenase [ Homo sapiens (human) ] |
Official Symbol | XDH |
Synonyms | XDH; xanthine dehydrogenase; xanthene dehydrogenase; xanthine dehydrogenase/oxidase; XO; XOR; xanthine oxidase; xanthine oxidoreductase |
Gene ID | 7498 |
mRNA Refseq | NM_000379 |
Protein Refseq | NP_000370 |
MIM | 607633 |
UniProt ID | P47989 |
◆ Recombinant Proteins | ||
XDH-18H | Recombinant Human XDH protein, MYC/DDK-tagged | +Inquiry |
XDH-16B | Recombinant Bovine XDH protein, His/T7-tagged | +Inquiry |
XDH-4041H | Recombinant Human XDH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
XDH-9951HFL | Recombinant Full Length Human XDH protein, Flag-tagged | +Inquiry |
XDH-43H | Recombinant Protein Human XDH Protein, 1234-1332, N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XDH-265HCL | Recombinant Human XDH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XDH Products
Required fields are marked with *
My Review for All XDH Products
Required fields are marked with *
0
Inquiry Basket